KEGG   Paenibacillus terrae: HPL003_05890Help
Entry
HPL003_05890      CDS       T01668                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pta  Paenibacillus terrae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1236042..1238186)
Genome map
AA seq 714 aa AA seqDB search
MRSFLYKSLGLVLVGVLLLPVGWWGLSVAEATPTVEHSQSVADTVLSTGSVNKTIGTYGF
EQGNVEGWKPRGTYTQIATVSEAAYGGVHSLKVTARTEVWNGAELDVKSLLQPGVEYEIS
GYVKQDGNSTTPSVIKFTVEQQPTGGATTWKTVAQTETTDTSWAKLQGTYTFTGGMDTLK
LYVESSNPAQAYYLDEVEIRQVSETPTTPPTEPTSGIESRFEDGTAQGWVSRMGTETVQV
SNADARTGSYSLLTTGRQQTYAGPKLDVTATVQKGSRYTVSAWVKLAPGEQQPAKVRLSV
QRDHQGESTYETVVGNTAITTGGWTHLYGTYTLAHEADTVSMYLETPEGTASFYMDDFEL
SLVPPLAIEKDIPSLHGLYQGQFSIGTAIEAFQTEGAYGELVQKHFNSVVAGNAMKPISL
QPSEGQFHWEEADRIVQFAQQHGIAIRFHTLVWHNQTGDWMFKDKNGQPMTPTAENKKLL
LDRLETHIRAVAARYKNVITDWDVVNEVIDPDQPDGMRRSKWYQITGTDYIDKAFRVTRE
AAGPNARLYINDYNTHEPKKRDFLYNLVRDLLAKGVPIDGVGHQSHIRLEFPAIDEMEQS
IEKFASLGLDNQITELDMGLYSNDTDHYETIPEAMLIRQAHRYRALFDMFSRQQEHISNV
TIWGTDDGNTWLSMFPIARLDKPLLFDERLKAKYAYWALVDPSKVPPLPAGSNE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtcatttttgtataaatctttgggtctggtgctggtcggggtgttgttattgcca
gtggggtggtgggggctgtctgtagcggaggcgactccaactgtggaacattcccagtca
gttgcggatacggttctgtcgacggggagcgtgaataagaccatcgggacgtatggattt
gagcaaggcaacgttgagggctggaagcctcgggggacttatacccaaatcgcaaccgtc
tcagaagctgcatatggcggcgtacacagcctgaaggtaaccgctcgcacggaggtttgg
aacggtgcggagctggatgtgaagtcgctgttgcagccgggtgtggaatatgagattagc
ggctatgtgaagcaggacggtaattctacgacgccgagcgtgattaagtttacggtggag
cagcagccgacaggcggggccacgacatggaagacggttgcgcagacagagacgacggat
acatcgtgggccaaacttcaagggacatatacattcaccggggggatggatacattgaag
ttgtatgtggaaagctcgaatcctgcacaggcctattatctggatgaggtggaaatcagg
caggtgtcggagacaccaaccactcccccaacggagccgacaagtggtatcgaatccaga
tttgaagatggtacggctcaaggctgggtatcccgtatgggcaccgagacggtgcaggtg
tcgaatgccgatgcacgaaccggatcgtacagtctgttgacgacaggcagacaacaaaca
tatgccgggccaaagctggacgtgactgctacagtgcaaaaaggcagccgttacacggtc
agcgcttgggtaaagctggcaccgggcgagcagcagcctgccaaggtgcgcctcagcgta
cagcgcgatcatcaaggtgaaagtacgtatgaaactgtggtaggcaacacggccatcacg
actgggggatggacgcatttgtacggaacgtatactctcgcgcatgaggcagacaccgtc
tctatgtatttggaaacgccagaaggtacggcttccttttacatggatgatttcgagctg
tcgcttgtgccgccgttggctattgagaaggacattccctctttgcatggattgtatcag
ggacagttcagcatcggtacggctattgaagctttccagacagaaggggcttacggggag
ctggtgcagaagcattttaacagcgtcgtcgccggaaatgcgatgaagccgatctccttg
cagccgtccgaaggacagttccattgggaagaagcagaccggattgtgcaatttgcccag
cagcatgggattgctatccgtttccatacactggtgtggcataaccagaccggcgattgg
atgtttaaggataagaatggacagccgatgacgccgaccgcggaaaataaaaagcttttg
ctggatcggctggagacgcatattcgtgctgttgcagcccgttataaaaatgtaatcacc
gattgggatgtggtgaatgaagtcattgatcccgaccagccggacggtatgcgccgcagc
aagtggtatcagattaccggcacggattatattgacaaagcattccgtgtcacgagggaa
gcggcgggtccgaacgcccggctgtacattaacgattacaacacgcatgaaccgaagaaa
cgggattttctgtacaatttggtgcgtgatttactcgctaaaggcgtaccgatcgatggc
gtaggtcaccaatcgcatatccgcctggagttccctgctattgacgagatggagcagtct
attgaaaagtttgcttcgctcggcctggataatcagatcacggagctggatatgggcctg
tattctaatgatacagaccactacgaaacgatacctgaagccatgctgatccggcaggct
caccgctatcgggcgttgttcgatatgttttcccgacagcaggagcatatcagtaatgtg
acgatttggggtacggatgatggaaatacgtggctcagtatgttcccgattgcccggctg
gataagccgctgctgttcgacgaacggttaaaggccaaatatgcctattgggcgcttgtt
gacccgtccaaagtaccgccgctgccagcggggagcaacgaatag

DBGET integrated database retrieval system