KEGG   Paenibacillus terrae: HPL003_06330Help
Entry
HPL003_06330      CDS       T01668                                 

Definition
alpha amylase catalytic domain-containing protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pta  Paenibacillus terrae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HPL003_06330
Enzymes [BR:pta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HPL003_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365588..1367042)
Genome map
AA seq 484 aa AA seqDB search
MSIKNEIMLITYADSMGKNLKELGELLNDHFKQVIGGVHLLPFYPSSADRGFAPTTYENV
DAPFGDWEDIKRLSQDFYLMFDFMINHISRSSAYFQDFVQHKDASPYADLFIRYKDFWPN
GEPTQEEVDLIYKRKPRAPYIDVEFKDGTTEKVWCTFDEEQVDLNLHSDVTQQFVRENLI
RLSEKGASIIRLDAFAYATKKRGTNCFFVEPEIWDMLGEAQEILKPYGVDVLPEIHEHYS
IQLKLAEKDHWVYDFALPMLVLHALYSGNSKRLTHWLNICPRKQFTTLDTHDGIGVVDAK
GLMTDEEIEETKNNLFSKGANIKRVYNTAAYNNLDIYQLNCTYYSALGNNDDAYVLARAI
QFFAPGIPQVYYVGLLAGENDIALLEETKVGRNINRHYYSQEEVIENLERPVLKRLFQLM
KFRNSYPAFDGEIKIVEAGNSDQLEIEWEKGGYRVLLKANVRTHAFTVDYVDLEKGSLVR
LTGV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgtccatcaaaaatgaaattatgcttattacttatgcagacagcatggggaagaatttg
aaagagctgggggaactgctaaacgaccattttaaacaggttatcggtggcgtccatttg
cttcctttttatccgtcttcggcagaccgtggctttgctccgacgacctatgagaacgtt
gatgcaccctttggtgactgggaagatattaaacggctgtctcaggacttttacctcatg
tttgattttatgattaatcatatctctcgcagctcggcgtattttcaggactttgtccaa
cataaagacgcttcgccgtacgccgacttgtttatccggtacaaggatttttggccgaat
ggagagcccactcaggaagaagtggatttgatttataaaagaaagccacgtgcgccttat
attgatgtcgagtttaaggatggtacgacggaaaaggtatggtgtacctttgatgaggaa
caggtggatcttaatctgcactcggacgtgacccagcaatttgtcagagaaaacctgatt
cgtttgtctgaaaagggtgcttcgatcatccgactcgatgcttttgcatatgctaccaaa
aaaagaggaaccaattgtttcttcgtggagcctgaaatttgggacatgcttggtgaagca
caggagatattgaagccttacggcgtcgatgttctgccggagattcatgagcattactcc
attcagttgaagcttgctgaaaaggatcattgggtttacgattttgccctacctatgttg
gtgctgcacgcattgtatagcggtaatagtaagcgtctcactcactggctgaacatctgt
ccgagaaagcagtttactacgctggatacgcatgatggaattggagtcgttgatgccaag
ggcttaatgacggatgaagagatcgaagagaccaaaaataatctgttctccaagggagct
aacattaaaagggtatacaatacggccgcctataataacctggatatctatcaactcaac
tgtacgtattattcagcactcggcaacaacgatgatgcctatgtactggctagagccatt
cagttttttgcaccgggcatcccccaagtctattatgtagggctgctggcaggtgaaaat
gacatcgcgctattggaagaaacgaaggtaggtcgtaacattaaccggcattactattcc
caagaggaagtcattgaaaacctggaaagacccgttttgaagcgattgtttcagttgatg
aaattccgcaattcctatcctgcttttgatggtgaaatcaaaatcgtagaagctggaaat
tccgatcagttggaaatcgaatgggaaaaaggaggctatcgtgtccttctgaaagccaac
gtgcggactcatgcatttacagttgattatgtagatctggaaaaagggtcccttgtgcgt
ctgacaggcgtttaa

DBGET integrated database retrieval system