KEGG   Paenibacillus terrae: HPL003_06715Help
Entry
HPL003_06715      CDS       T01668                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pta  Paenibacillus terrae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HPL003_06715
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HPL003_06715
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HPL003_06715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1435283..1435828
Genome map
AA seq 181 aa AA seqDB search
MSIYDFQATSIYGKPIKLSEYRGKILLIVNTASQCSFSRQFADLQKLYESRKRQGFEILA
FPCNQFNEKEPSSHSELQEIYQNGHGVTFPLFGKTDIRGSAPHPLFQYLTQQAPFQGFDS
QTKDGQWMEDFLRDKYPEIYAGDGIKWNFSKFLIDRDGHVNGRFESTTEPFEIDSIIESL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttatgatttccaagcaacctcaatttacgggaagccaattaaactatccgag
tatagaggaaaaattctcctgatcgtaaatacagccagccaatgcagcttctcccgccaa
tttgctgatctgcaaaagctctacgaaagtcggaagcgacaaggttttgaaattctcgcg
tttccatgtaatcaattcaatgaaaaagagccgagtagtcactcggaattgcaggaaatc
taccaaaatggacatggcgtaacgttcccgctatttgggaaaacggatataagaggctca
gcccctcatcctttatttcaatatctgacacaacaagcaccattccagggcttcgattcc
cagaccaaggacggtcaatggatggaggatttcctgcgagataagtatccggaaatatac
gctggcgacgggatcaagtggaatttctccaagtttctgatcgatcgcgatggtcatgta
aatggaagatttgaatcaacgacggagccctttgaaatagattctatcatcgaatcactg
ttgtag

DBGET integrated database retrieval system