KEGG   Paenibacillus terrae: HPL003_06765Help
Entry
HPL003_06765      CDS       T01668                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pta  Paenibacillus terrae
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    HPL003_06765
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     HPL003_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1443004..1443903)
Genome map
AA seq 299 aa AA seqDB search
MKKTKQLRELVNSQKLEFIMEAHNGLSAKIVEEAGFKGIWASGLSISAAMGVRDNNEASW
TQVLDVLEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQRHIAGVCIEDKRFPKMNSF
INGQGQTLADIEEFSGKIKAMKDTQTDEDFTVVARVEAFIAGKGLKVALQRAEAYRKAGA
DAVFIHSKRADAAEIEAFMKEWAGRLPIVIVPTKYYTTPTVRFQELGISLVIWANHNLRA
SIQAMQHLSNRIYRDESLVHIEKSVATLEEVFRLQGVEELQAAERQYFPSSEPDSGEHV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaagcagctaagagagttggtcaattctcaaaaactggagtttatcatg
gaagctcataatggtctgtcagccaaaattgtggaggaggcggggtttaaaggaatttgg
gccagcgggctatccatctctgcagcgatgggagtcagggacaacaatgaggcctcctgg
acgcaggttttggatgttttggaattcatgagtgatgctacctccatcccgattttgctg
gacggagatacggggtacggcaatttcaataatgcaaggcggctggtaaagaagctggag
cagcgccatattgcgggggtatgcatcgaagataagcggttccccaaaatgaattctttc
attaacggtcaagggcagactttggctgatatcgaggagttttccgggaaaataaaagcg
atgaaagacacgcaaaccgatgaggactttacagtggtggccagggtagaggcatttatt
gctgggaaagggcttaaagtggcgctgcagagggcagaggcgtaccggaaggcaggagcc
gatgccgtatttatacacagcaaaagagcggatgccgcagagattgaagcattcatgaag
gaatgggccggaagattgccgatagtgatcgtgcctaccaaatactatacgactccaacc
gtcaggtttcaggagttggggatcagccttgtgatttgggcaaaccataatttgagagca
tctattcaagccatgcagcatttatctaaccggatttatcgggatgaaagtcttgttcat
attgaaaagagtgtcgccaccctcgaagaagtattccggcttcaaggggtcgaggagctg
caagccgcggagcgccaatactttccgtcgtcagaaccggattcgggtgagcacgtataa

DBGET integrated database retrieval system