KEGG   Paenibacillus terrae: HPL003_06920Help
Entry
HPL003_06920      CDS       T01668                                 

Definition
xylanase b
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pta  Paenibacillus terrae
Brite
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     HPL003_06920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1473401..1474357)
Genome map
AA seq 318 aa AA seqDB search
MLKFKVGKLVSSLALAGLLFSSVLVNQADAGLAKGSKFLGNVIAGSVPSSYGTYWNQVTP
ENSTKWGAVEGSRNNMNWSQADMAYNYARSNGFSFKFHTLVWGSQEPGWVSRLSAADQKA
EVTQWIKAAGQRYSNAAFVDVVNEPLHQKPSYRNAIGGDGSTGWDWIIWSFQEARQAFPN
AKLLINEYGIIGDPSLTDQYVKIINLLKSRGLIDGIGIQCHHFNMDNVSVNTMNTVLNKL
SATGLPIYVSELDITGDDNTQLARYKEKFPVLWQHPSVKGVTLWGYIQGQTWKENTHLLN
SNGSERPALQWLRQYLGS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatttaaagtaggcaagttggtgagtagtttggcgttggcaggtctgttgttt
tcgtctgttctggtgaatcaggctgatgctggtctggcgaagggaagcaaattcctcggg
aatgtcattgccggcagtgtcccttctagttacggaacgtactggaatcaggtgacaccg
gagaattcaaccaaatggggcgcggtcgaaggcagtcgcaacaacatgaattggtcgcaa
gcggatatggcctacaattacgcccgtagcaatggcttctcattcaagtttcacaccttg
gtatggggcagtcaggagccaggatgggtaagcagactgtcggctgccgatcagaaagcg
gaagtgactcagtggatcaaagcagccggccagcgctattcgaatgcggcgtttgtagat
gtggtgaatgagccactgcatcagaagccgtcttaccgcaatgccattggcggtgatgga
tcgaccggatgggattggatcatatggtcattccaggaggccagacaagcttttccgaat
gccaagctgcttattaatgagtatggaattatcggcgatccttcattaacggaccaatat
gtgaagattattaatctgctcaagagtagagggctgattgatggaattggcatacaatgt
caccatttcaacatggataatgtctcagtcaatacgatgaatacggtattgaacaaatta
tcggcaactggattgccaatttatgtgtcggaactggatataactggtgatgataacacc
cagcttgccagatacaaggagaagttcccggtactctggcagcatccctcagtgaaggga
gttacgctctgggggtatatccagggacaaacctggaaggagaacacacatctgctgaat
tcgaacggctcggaacgccctgcgctccaatggctgagacaatatctgggtagctag

DBGET integrated database retrieval system