KEGG   Paenibacillus terrae: HPL003_07825Help
Entry
HPL003_07825      CDS       T01668                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pta  Paenibacillus terrae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPL003_07825
Enzymes [BR:pta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPL003_07825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671564..1672430
Genome map
AA seq 288 aa AA seqDB search
MNIPTIYRRSYRMGEAELTLGDSTQVMGILNVTPDSFSDGGLHNSPEIAVLHALKLVEDG
ADIIDIGGESTRPGHDPVGVEEELARVIPIVQAIHRIAPHIPLSVDTYKAEVARQALEAG
AHIINDVWGFKADPDMARVASQFDCPVILMHNRHDRNYSDFIPDMIDDLKESIGLALDAG
VRAEQIILDPGIGFAKDYDENIHAMTSLDTLCQLGYPLLLATSRKRFIRTALDLPVDDVV
EGTAATVAFGIAQGCQIVRVHDVAQIKRTVRMCDAMVYGSKNALSYGG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaatataccgaccatttaccgacgaagctaccggatgggtgaggccgagcttacgctc
ggagattccacacaggtgatgggtatactgaacgtgaccccggattcattttccgatggc
ggattgcacaatagtccggagattgctgttttacatgccttgaagctggtggaggatgga
gcagatattattgatattggcggggagtccacccggccggggcatgatcccgtaggcgta
gaagaagaactggcacgtgtcattccgatagtacaggctattcaccgtattgctccgcac
attccattatccgtggatacttacaaagctgaagtagcccggcaggcgcttgaagcaggc
gcgcatatcattaatgatgtgtgggggtttaaggcagaccctgacatggcacgtgtagct
tcacaattcgattgtcctgtcattttaatgcataatcgtcatgaccgtaactatagcgat
tttatacctgatatgattgatgatttaaaagaaagtatcggattggcgctggatgcaggt
gtacgtgcggaacagatcattttagatccgggcatcggatttgccaaagattacgacgaa
aatatccatgctatgacttctctggatacactatgtcaattgggctatccgctgttgttg
gcgacgtcacgcaaaagatttatccgtacagcgctggatttgcctgtagatgatgtggtt
gagggcacagcggctacggtcgcctttggcattgctcaaggttgtcagattgtgcgtgta
catgatgttgcgcaaatcaagcgcacggtgcgtatgtgtgatgcgatggtgtacgggtct
aaaaatgcactgagttatggggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system