KEGG   Paenibacillus terrae: HPL003_07835Help
Entry
HPL003_07835      CDS       T01668                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pta  Paenibacillus terrae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPL003_07835
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPL003_07835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673019..1673567
Genome map
AA seq 182 aa AA seqDB search
MNAHSTSEASEAYIALGANLGDREHTLYEAITALDEHPGIRVLRCSSLYETEPVGYLDQP
SFLNMTVAASTTLAPEELLAFMLEVESRLGRVRHIPNGPRTIDLDLLWMEAVQLNTPDLE
LPHPRMLVRAFVLVPLADIVPNQDPSGLYSIVHTALKSLDGKDGIQFWKTCSWRNGFAPF
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacattcgacctctgaggcatcagaggcttatattgctttaggggctaatttg
ggggatcgtgagcacaccctgtatgaagccatcacggcgctggacgaacatccgggtata
cgggtgcttcgttgctccagcctgtacgaaacggagcctgtcgggtatctggatcagcct
tcttttctaaacatgacagtagccgcatccacaacacttgctccagaggagcttctggcc
ttcatgctggaggtagagagtcgtctgggtagagtaagacatattcctaacggtccgcgc
accattgatctggatttgttatggatggaagcggtgcagctcaatacaccggatttggag
cttcctcatccccgcatgctggtgcgtgcttttgtgcttgtgccattagctgacatcgtt
ccgaaccaagatccatccggtctgtacagtatcgtgcatactgcattgaaatcattggat
ggaaaggacggcatacagttttggaaaacatgcagctggcgcaacggcttcgcgcctttc
ggaagctaa

DBGET integrated database retrieval system