KEGG   Paenibacillus terrae: HPL003_07985Help
Entry
HPL003_07985      CDS       T01668                                 

Definition
PTS system glucose-specific transporter subunit IIA
Orthology
K02777  
PTS system, glucose-specific IIA component [EC:2.7.1.69]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)
Module
PTS system, glucose-specific II component
PTS system, trehalose-specific II component
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_07985
   00500 Starch and sucrose metabolism
    HPL003_07985
   00520 Amino sugar and nucleotide sugar metabolism
    HPL003_07985
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    HPL003_07985
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     HPL003_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707256..1707762
Genome map
AA seq 168 aa AA seqDB search
MFKWLKKKVAPRIEEFDMVAPIRGQVVSLEEVPDPAFSTKAMGEGIAIHPSEGRVTAPFT
GKVAHVMEKSKHALIIEHESGAQVLIHVGINTVSLKGKGFNPHVQTGDNVKAGQLLMEFD
LDAIQEEGLPVITPVIVPDGQEMISHVEILEGSSASPDAPVLRVYLKA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatggttgaaaaagaaggtggctcctcgtattgaagaattcgacatggtagca
ccaattagaggacaagtggtttcccttgaagaagttccagatcctgctttttctacgaag
gctatgggggaaggcatcgctattcatccgtctgaaggcagggtcacggctccttttacg
gggaaagtcgctcatgtgatggagaaaagtaagcacgcgctgatcattgaacatgaatcc
ggtgcacaagttttgatacatgtcgggattaataccgtctcactcaaagggaagggcttt
aaccctcatgtccaaacaggagataacgttaaagcggggcaattattgatggagtttgat
ctggacgctattcaagaggagggattgcctgtaattactccggtaatcgttccagatggg
caagagatgatcagtcatgtggaaatattggaaggctcgtctgcttctcctgatgcacct
gtattgagagtctatttgaaagcctag

DBGET integrated database retrieval system