KEGG   Paenibacillus terrae: HPL003_07985Help
Entry
HPL003_07985      CDS       T01668                                 

Definition
PTS system glucose-specific transporter subunit IIA
Orthology
K02777  
PTS system, glucose-specific IIA component [EC:2.7.1.69]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Phosphotransferase system (PTS)
Module
PTS system, glucose-specific II component
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pta00010]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pta00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pta00520]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:pta02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707256..1707762
Genome map
AA seq 168 aa AA seqDB search
MFKWLKKKVAPRIEEFDMVAPIRGQVVSLEEVPDPAFSTKAMGEGIAIHPSEGRVTAPFT
GKVAHVMEKSKHALIIEHESGAQVLIHVGINTVSLKGKGFNPHVQTGDNVKAGQLLMEFD
LDAIQEEGLPVITPVIVPDGQEMISHVEILEGSSASPDAPVLRVYLKA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatggttgaaaaagaaggtggctcctcgtattgaagaattcgacatggtagca
ccaattagaggacaagtggtttcccttgaagaagttccagatcctgctttttctacgaag
gctatgggggaaggcatcgctattcatccgtctgaaggcagggtcacggctccttttacg
gggaaagtcgctcatgtgatggagaaaagtaagcacgcgctgatcattgaacatgaatcc
ggtgcacaagttttgatacatgtcgggattaataccgtctcactcaaagggaagggcttt
aaccctcatgtccaaacaggagataacgttaaagcggggcaattattgatggagtttgat
ctggacgctattcaagaggagggattgcctgtaattactccggtaatcgttccagatggg
caagagatgatcagtcatgtggaaatattggaaggctcgtctgcttctcctgatgcacct
gtattgagagtctatttgaaagcctag

DBGET integrated database retrieval system