KEGG   Paenibacillus terrae: HPL003_07995Help
Entry
HPL003_07995      CDS       T01668                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pta01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pta01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pta00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:pta00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pta00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1708857..1709402
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAKATGQEPDARLTDEGIQQAEQLADFMENVGVEYIVSSPWERAVRTIQPLA
ERKQLQVYTDLRLQERVLSHEHLDHWMDVLKQTYLDEDFKLEGGESSREAADRGIQLVQE
LIERTEKTIIIVTHGALLSLLIRHYDSQFGFEEWKTLSNPDVYLLEIKEAEAQIRRVWTT
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatttactttgtgagacatgccaaagcgacaggacaggagccagatgcccga
ctcactgatgaaggtatccaacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatatcgtatccagcccgtgggaacgggccgtgcgaaccattcagcctttggct
gaacggaaacagttgcaggtatatactgatctacgtcttcaggaacgggtgcttagccat
gagcatttggatcattggatggacgtgctgaaacagacctatctggacgaggatttcaag
ctggagggaggggaatcatctcgtgaagcggcagatcgaggaatacagcttgttcaggag
cttatagaacggacagaaaaaacgatcatcattgtaactcatggggctctgctgtcactt
ctcattcgacattacgattcgcagtttgggtttgaggagtggaaaacactttcgaatcca
gacgtatatttgcttgaaatcaaagaagcagaggcccagattcgcagagtgtggactacg
gagtga

DBGET integrated database retrieval system