KEGG   Paenibacillus terrae: HPL003_07995Help
Entry
HPL003_07995      CDS       T01668                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_07995
   01230 Biosynthesis of amino acids
    HPL003_07995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_07995
  Energy metabolism
   00680 Methane metabolism
    HPL003_07995
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_07995
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HPL003_07995
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HPL003_07995
  Exosomal proteins of melanoma cells
   HPL003_07995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1708857..1709402
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAKATGQEPDARLTDEGIQQAEQLADFMENVGVEYIVSSPWERAVRTIQPLA
ERKQLQVYTDLRLQERVLSHEHLDHWMDVLKQTYLDEDFKLEGGESSREAADRGIQLVQE
LIERTEKTIIIVTHGALLSLLIRHYDSQFGFEEWKTLSNPDVYLLEIKEAEAQIRRVWTT
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagatttactttgtgagacatgccaaagcgacaggacaggagccagatgcccga
ctcactgatgaaggtatccaacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatatcgtatccagcccgtgggaacgggccgtgcgaaccattcagcctttggct
gaacggaaacagttgcaggtatatactgatctacgtcttcaggaacgggtgcttagccat
gagcatttggatcattggatggacgtgctgaaacagacctatctggacgaggatttcaag
ctggagggaggggaatcatctcgtgaagcggcagatcgaggaatacagcttgttcaggag
cttatagaacggacagaaaaaacgatcatcattgtaactcatggggctctgctgtcactt
ctcattcgacattacgattcgcagtttgggtttgaggagtggaaaacactttcgaatcca
gacgtatatttgcttgaaatcaaagaagcagaggcccagattcgcagagtgtggactacg
gagtga

DBGET integrated database retrieval system