KEGG   Paenibacillus terrae: HPL003_08195Help
Entry
HPL003_08195      CDS       T01668                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
pta  Paenibacillus terrae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPL003_08195
DNA repair and recombination proteins [BR:pta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPL003_08195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756175..1756774
Genome map
AA seq 199 aa AA seqDB search
MYYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLKMKEDDVIDFAKALVNVKRNLHFCSVC
GNITDTDPCRICQDKTRDASVICVVQDSKDLVAMERTKEFNGSYHVLHGAISPMEGIGPE
DIKLKELLNRLSDERIKELILATNPNIEGEATAMYISRLVRPFGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtattatccggagccgattgcaaagctgattgatgcatttacgcgcctgccgggagtg
gggccgaagacggctgcccggttggcttttcacgttctgaaaatgaaggaagacgatgtg
attgattttgccaaagcgctggtcaatgtgaaacgcaatcttcacttctgttccgtctgc
ggcaatattacggacacggacccttgtcggatctgtcaggataagacgagggatgcttcc
gtcatttgtgttgttcaggattccaaggatttggtagctatggagcgcaccaaagagttt
aatggctcctaccatgtgcttcatggggcgatctctcctatggagggaattggccctgag
gatatcaagcttaaggaattattgaacaggctcagtgatgaacgcatcaaagagctgatt
ttggctacgaatccgaacattgaaggagaagcgacggccatgtacatttccaggctggtg
cgtccttttgggatcaaggttacccgtatcgctcacggattgccggttggcggggatttg
gagtatgccgatgaggttacactgtccaaggcgctggaaggccgcagagagctgaactaa

DBGET integrated database retrieval system