KEGG   Paenibacillus terrae: HPL003_08390Help
Entry
HPL003_08390      CDS       T01668                                 

Definition
(RefSeq) Triosephosphate isomerase (Triose-phosphate isomerase)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_08390
   01230 Biosynthesis of amino acids
    HPL003_08390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_08390
   00051 Fructose and mannose metabolism
    HPL003_08390
   00562 Inositol phosphate metabolism
    HPL003_08390
Enzymes [BR:pta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPL003_08390
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPL003_08390
  Exosomal proteins of bladder cancer cells
   HPL003_08390
  Exosomal proteins of melanoma cells
   HPL003_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1798774..1799526
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTNLPALVEAVKGTSIKI
GAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNETDETVNKKVHAAFRHGL
TPIVCVGEKLEDREADQTKEVVKVQTVAAFAGLAKDQAAQVVVAYEPIWAIGTGKSSTSQ
DANEVISYIRSLLKELYDENTANAVRIQYGGSVKPENVAEYMGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacaccgattatcgcgggtaactggaagatgtttaaaaccgtaccagaagctaaa
actttcatcgaagagatcaaaggcaaagcagaggttgcaggagtggaaagcgtaatctgc
gctccatttacgaatcttcctgctctggttgaagcagtaaaaggcacatctatcaaaatc
ggcgcacaaaacctgcactttgcagaagacggcgcatttacaggtgaaatcagcggcggg
atgctgaaagatctgggcgtagactatgttgtgatcggacactccgagcgtcgtgaatat
tttaacgaaacagacgaaacggtgaacaaaaaggttcatgcggcattccgccacggcctg
actccgatcgtatgtgtaggcgaaaagctggaggaccgtgaagccgatcaaaccaaagag
gttgtaaaagtacaaactgtagcagcttttgctggtttggctaaagatcaggctgcacaa
gtggttgttgcttatgagccaatctgggcaatcggaacaggtaaatcatccacttcgcag
gatgcgaatgaagtgatttcctacatccgcagtcttctgaaagaactgtacgatgaaaat
acagcaaatgctgtacggattcagtatggtggcagcgtcaaacctgaaaatgtggccgag
tacatgggccaaagcgacatcgacggcgcactcgtaggcggcgctagtcttcaaccagcg
tcttacatcgcgcttgttgagggggcgaagtaa

DBGET integrated database retrieval system