KEGG   Paenibacillus terrae: HPL003_09510Help
Entry
HPL003_09510      CDS       T01668                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_09510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_09510
   00052 Galactose metabolism
    HPL003_09510
   00500 Starch and sucrose metabolism
    HPL003_09510
   00520 Amino sugar and nucleotide sugar metabolism
    HPL003_09510
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPL003_09510
   00524 Butirosin and neomycin biosynthesis
    HPL003_09510
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPL003_09510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2056105..2057040
Genome map
AA seq 311 aa AA seqDB search
MVDAVNRVIGIDIGGTSVKAAIVEQDGSVLDEIRLDTDASRGRDWVLSRVSEAVRGLQCS
YRDTSTSEGIDIRALGIATAGRVNVESGEVVYATDNLPGWQGTHLITWVRENLALRAVAD
NDANAALLGEAWQGAGRGKQRLAMLTLGTGVGGAYMEHGLLCRGAHWSGGDWGHSILFPR
GLPCNCGKKGCAEQYVSGSALLRRAREYTGKQYRSGIEIMKEAAHGHSEALQVLDDYTAD
LAVLLVNISVTLDPEAMIVGGGVADAGEVWWPLLEKHLQLLGARTEVNRALLGNRAGIIG
AARLAFELTDA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtggtggatgctgtgaacagagtcattggaatcgacattggaggaacatcggtgaaggcc
gctatagtggaacaagatggttcggtgcttgatgaaatccggctggatacggatgcttct
cgcgggcgtgattgggtattgtcacgggtatccgaagctgtgagaggactgcaatgctcc
tatagagacactagcaccagcgagggtatcgatatcagagctctaggaattgctacggct
ggcagagtaaacgtggagagtggtgaggttgtgtatgccacggataatcttcccggatgg
caaggcacgcatttaataacgtgggtgagggagaatcttgccttacgtgccgttgctgac
aatgatgcgaatgccgctttgcttggagaagcgtggcagggagcggggaggggcaagcag
cggctggccatgctcaccttgggaacaggcgtcggtggcgcatatatggaacatggcttg
ttgtgcagaggggctcattggagcggcggcgattggggacatagtattttattcccaaga
ggtcttccttgcaattgtggaaaaaagggctgcgccgagcagtatgtatcaggtagcgca
ctgttacgccgggccagagaatacacaggtaaacagtatcgctcgggaatcgagatcatg
aaggaggctgctcacggtcactcggaggcgcttcaggtactggacgattacaccgcagat
ttagccgtgcttctggttaatatctcggtcacccttgatcccgaggctatgatcgtaggc
ggaggggtagcagacgcgggagaagtctggtggcccttgctggagaagcatctacaactg
ctgggagcccgaacggaagtaaatcgggcgttattgggtaatcgtgctggaatcatcggt
gcggcacggcttgcttttgaactaacggatgcctag

DBGET integrated database retrieval system