KEGG   Paenibacillus terrae: HPL003_11455Help
Entry
HPL003_11455      CDS       T01668                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pta  Paenibacillus terrae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPL003_11455
Enzymes [BR:pta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HPL003_11455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470060..2470653
Genome map
AA seq 197 aa AA seqDB search
MAGVKDYINRKAADNRDKIEYHVEQILQLIGEDPKREGLLETPARVARMYEEIFAGYEVD
PRDALGVTFDENHEELVIVKDIVYYSQCEHHMAPFFGKVHIGYVPSGKIVGLSKLARLVE
AVTRRLQVQERITAQIADILNEAVSAHGVMVVVEGEHLCMCSRGVKKPGSKTVTSAVRGT
FRDDAAQRAEFLSLLKD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggctggcgtaaaagattatattaaccgcaaagctgcggataaccgggataaaatcgag
taccatgtggagcaaattctacaactgatcggtgaggaccccaagcgtgaaggcttgctg
gaaacaccggcacgcgtagcgcgcatgtatgaggagatatttgcaggttatgaggttgat
ccccgggatgcgctgggtgtaacattcgacgaaaatcacgaggagcttgtaattgtgaag
gacatcgtctattacagccagtgtgagcaccatatggctcctttcttcggaaaagtgcat
atcggctacgtacccagcggcaaaattgtaggactaagcaagcttgcccgtctggttgag
gctgtgacgcgccgtttgcaggttcaggagcgcattacggcacagatcgcagatattttg
aatgaagcggtctccgctcacggggttatggtggtcgtggaaggcgaacacttgtgcatg
tgctcaagaggcgtcaaaaagcctggcagcaaaacggtaacatctgcggtacgcggaacg
tttcgtgatgatgctgcgcagcgtgcagagttcctctcgctgctcaaggattga

DBGET integrated database retrieval system