KEGG   Paenibacillus terrae: HPL003_12345Help
Entry
HPL003_12345      CDS       T01668                                 

Definition
hypothetical protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
pta  Paenibacillus terrae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPL003_12345
   00240 Pyrimidine metabolism
    HPL003_12345
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     HPL003_12345
    2.7.1.76  2'-deoxyadenosine kinase
     HPL003_12345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2656591..2657232
Genome map
AA seq 213 aa AA seqDB search
MNKYNIPANALITVAGTVGVGKSTLTAALAERLGFKTSLEKVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFLSGGGFVQDRSIYEDTGIFAKMHADQGTMNPTDYETYTSLFE
AMVMTPFFPHPDVLVYLEGSLPSILSRIEERGREMEIQTERSYWEQMYRRYSDWINEFEA
CPVLRLNIDEYDVHDPASMDAILVEVGKVISKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatacaacattcccgcgaatgccctgattacggtagcgggcacggtaggtgtg
ggtaaatccacactaacggctgctttggctgaacgcctgggttttaaaacctcactggag
aaggtagatcataatccatatctggagaagttttatcacgacttcgaaagatggagcttt
catctgcaaatttattttctggccgagcgcttcaaggagcaaaaaaacattttcttatcc
ggtggaggatttgtacaggaccgttcgatttatgaggacacaggaatttttgccaaaatg
catgccgatcaggggacgatgaaccctacggattatgaaacgtataccagtctgtttgag
gctatggtgatgacaccgtttttcccccacccggatgtgctggtctacctggaaggcagc
ttgccatccatactgagccggattgaggaacgcggtcgcgagatggaaatccagacagag
cgatcttattgggagcagatgtatcgcagatattccgattggatcaacgagttcgaggcc
tgtcctgtgctgcgtctgaacattgatgaatatgacgtgcatgatcccgcttctatggat
gccattttggtagaggtaggcaaggttatctccaaaaaataa

DBGET integrated database retrieval system