KEGG   Paenibacillus terrae: HPL003_12515Help
Entry
HPL003_12515      CDS       T01668                                 

Definition
beta-1,6-glucanase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pta  Paenibacillus terrae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    HPL003_12515
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HPL003_12515
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     HPL003_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2697844..2699403
Genome map
AA seq 519 aa AA seqDB search
MKAETEGRLRTMKKPQKQRRSNMRLLVAATAILVCAILISIAIRNSPEPKAESNVSMWLT
SPDPANRLTEQAPIHWSNDNAKGSTVNSNVLTVEVKPDIRYQTMEGFGAAVSGSSAYLMN
HGMSPDQRDQLLNDLFTASGIQLSYIRHTIGASDYSVDEQGQPSSYTYDDVASGKDYDLN
RFSIAKDQDVTDVLKQIVRRNSGLRIMGTPWTAPPWMKYGEQTYNGWYLDYNDPRVYSAY
ADYFVRYIQAYANEGIPIQAISIQNEPEFTTSNYPSMSMGAAEQANFIKQYLGPALSRNQ
LSTQIIAFDHNWDTGSDYARTVLGDEQARSYTHGTAFHCYKGEPTAMTDVHNAFPNKAVY
MTECSGGQWSPDFGDNLSWDMSKLIIGAPRNWSQNVLFWNVALDPSGGPTNGGCTNCRGV
VTIDPLSGAVTKNVEYYAIGHASKFVRPGAVRIDSTHYSGSIETVAYRNPDGTLVLIAAN
TGADERTFKVRQGSKVFTCKLPAKSAATFQWNSSASFKK
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctgaaacagaaggaaggctgaggacgatgaagaaaccccaaaagcaacgacgt
tccaacatgcggctgctcgtagctgcaactgcgattttggtatgtgctattctgatcagt
atcgctatacggaatagccctgagccgaaagcagaaagcaacgtcagcatgtggctgacg
tcaccggacccggcgaatcgcctgaccgagcaagctccgatacattggagtaacgataat
gctaaaggcagcacagtcaactcgaacgtactgacggttgaggtgaagccggatattcgt
taccaaacgatggaggggttcggcgcagcggtatccggttcatccgcttatctcatgaat
cacggcatgtctccggatcagcgtgaccagttactcaacgatttgtttaccgcgagcggt
attcaattgagctatattcgccacaccatcggggcatccgattattcggtggatgaacag
ggacagcccagcagctatacctatgacgatgtggcatcaggcaaggactatgatctgaac
cgcttttccattgccaaggatcaggacgtgacggatgtgctaaagcagatcgtacgcaga
aattctggccttcggattatgggaaccccgtggactgcgccgccctggatgaaatatggg
gagcagacctacaatggctggtatttggactataacgatccgcgcgtctattccgcatat
gctgactattttgtacgttatatccaggcttatgcgaacgaaggcattccgattcaggcg
atttccattcaaaatgagccagaattcaccacgtccaactatcccagcatgagtatgggg
gcagccgagcaggcaaactttattaagcaatatttgggtcctgccttaagtcggaaccaa
ttgtccacccagattattgcttttgaccataactgggataccgggagtgattatgcccgc
acagtgttgggagatgagcaagcccgaagctatacgcacggcacggcctttcactgctac
aaaggagagcccacagcgatgacagacgtgcataatgcctttccgaacaaggctgtgtac
atgacagaatgcagtggggggcagtggagcccggattttggggataatttgagctgggat
atgtccaagctgatcatcggcgctcctcggaactggtcgcaaaatgtcctgttttggaac
gtggcgcttgatccatccggcggcccgacaaatggtggctgtaccaactgtcgcggtgtg
gttaccattgatccattgagcggtgccgttacgaagaatgtggagtactatgcgattgga
catgccagcaaatttgtccgcccgggtgcggtacgtattgattccacgcattacagcgga
agtattgaaacggtcgcctaccgtaaccccgacggtacccttgtcctgattgcggctaat
acgggagcagacgagcggactttcaaggttcggcagggaagcaaagtctttacctgcaag
cttcctgccaaatcggcagctacctttcaatggaactcttcggcttccttcaaaaagtga

DBGET integrated database retrieval system