KEGG   Paenibacillus terrae: HPL003_12895Help
Entry
HPL003_12895      CDS       T01668                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
pta  Paenibacillus terrae
Pathway
pta00052  Galactose metabolism
pta00561  Glycerolipid metabolism
pta00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HPL003_12895
  Lipid metabolism
   00561 Glycerolipid metabolism
    HPL003_12895
   00600 Sphingolipid metabolism
    HPL003_12895
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HPL003_12895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AET59332
UniProt: G7VWD1
Position
2770535..2771833
Genome map
AA seq 432 aa AA seqDB search
MSKITFLGAGSTVFAKNVLGDCMLTPALQGFELALFDIDPERLKDSENILSNLKKTTGST
CVIRSYTDRKEALRGAAYVVNAIQVGGYDPCTITDFEIPKKYGLRQTIADTVGIGGIFRN
LRTIPVMLDFAADVREVCPDAWFLNYTNPMAVLTNVMNVYGGVRTVGLCHSVQACIPELF
KSLGLEQEGVKAKIAGINHMAWLLEVSKDGEDLYPEIKKRAAAKRQEKHHDMVRFEMMLK
FGYYITESSEHNAEYHPYFIKRAYPELIERFNIPLDEYPRRCVSQIERWETMRGELLGNQ
DLRHERSNEYASYILEAIETDRPFTIGGNVMNTGLITNLPKEACVEVPCLVNRNGVTPTF
VGDLPPQCAALNRTNINTQLLTIEAAVTGKKEHIYHAALLDPHTSAELSMDEIVSLCDEL
IAAHGEWLPAYV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattacatttctgggtgcaggcagcacggtatttgccaaaaatgtgcttggt
gattgtatgttgacacctgctttgcagggctttgagctggcgttgttcgatattgacccc
gaaagactgaaggattcggaaaatattttatccaatttgaaaaaaacgacgggcagcacc
tgtgtgattcgctcctacacagaccgtaaggaagcgctgcgtggagctgcctatgtggta
aatgccattcaggtaggtggctatgatccgtgtacgattacggattttgaaattcctaaa
aaatacggcctgcgccaaacgattgccgatacggtcggaattggtggtattttccgcaac
ctacgaacgattccggtgatgctcgattttgccgcagatgtgcgcgaggtatgcccggat
gcatggtttctcaactatacgaatccgatggctgtgctgacgaatgtgatgaacgtatac
ggcggtgtccgtacagtagggctgtgtcatagcgtgcaggcatgtataccggagctgttc
aaaagcctaggactggagcaggaaggcgtgaaggcgaaaatcgcaggcatcaatcatatg
gcgtggctgctcgaagtgagcaaggacggcgaggatttgtatcccgagattaaaaaacgg
gccgccgccaagcggcaggaaaagcatcatgatatggtgcgctttgaaatgatgctgaaa
ttcggctattacattacggaatcgtccgagcataatgcggagtatcatccatattttatc
aagcgggcataccctgaactgatcgaacggttcaatattcctttggatgagtacccgcgt
cgctgtgtgagccagattgaacgatgggaaacgatgcgcggggagcttttgggaaatcag
gatctacgtcatgagcggtcgaatgaatatgcttcctatattttggaggctatcgaaacg
gatcggccttttaccattggcggcaatgtgatgaacacaggtttaattaccaatctgccg
aaagaagcatgtgtggaggtgccttgtctggtgaatcgcaacggggttacgccgaccttt
gtcggagatttgccgccccaatgcgctgcgctgaaccggacgaatattaatacacagctg
ttgacgattgaagctgctgtcaccgggaaaaaagagcatatttatcatgccgcactgctg
gacccgcacacatcagccgagctgtccatggatgagattgtttcgctgtgcgatgaactg
attgcggcgcacggagagtggcttccagcctatgtataa

DBGET integrated database retrieval system