KEGG   Paenibacillus terrae: HPL003_13180Help
Entry
HPL003_13180      CDS       T01668                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pta  Paenibacillus terrae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pta00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pta00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pta00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2847669..2849183
Genome map
AA seq 504 aa AA seqDB search
MSFKVAFIGAGSIGFTRGILRDLLAVPEFNEIEVAFTDISQHNLDMVTELCQRDIRENGL
SIQIQSSTDRKVALKDAKYVICTIRVGGLEGFATDVDIPLKYGVDQCVGDTLCAGGIMYG
QRGIAEMLEICKDIRELSAPDVLLLNYSNPMAMITWACNKYSGVRTIGLCHGVQHGHHQI
AEVYGLEKQDVDIVCAGINHQTWYIQASHEGKDLTVGLLEAFEQHPEYSRTEKVRIDMLR
RFGYYSTESNGHLSEYVPWYRKRPDEILDWIDLGSWINGETGGYLRVCTEGRNWFETDFP
NWMKEDPLVYKAENRGEEHGSYIIEGLETGRVYRGHFNVVNNGVISNLPDDAIIEAPGYV
DRNGISMPHVGELPLGPAAVCNVSISVQRLAVEAAVHGDDKLLRQAFMMDPLVGAVCNPK
EIWQMVDEMLVAQEAWLPQYGAAIAEARQRLAEGDLIPTRAYEGAARLKVKTIEEMQLDR
EAANKNAGESDKGKEREKVEPSKV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatttaaagtagcttttattggagcgggaagtattggttttacccgtggaattttg
cgagacctgttggcggtgccggaatttaacgagattgaagtggcttttacagacattagt
cagcacaatctggatatggtcactgagctgtgccagcgggatattcgggagaacggtttg
tctattcaaatacagtcctccacggatcgaaaggtagctttaaaggatgccaaatatgtg
atttgtacgatccgggttggcgggctggaaggctttgcgaccgatgtagacattccgctg
aaatatggcgtggatcaatgtgtgggcgatacgctgtgtgcaggaggtattatgtacggg
cagcgtggtattgcggaaatgctggagatctgcaaggatatccgcgagctaagcgctccg
gatgtgctgctgctgaactactcgaacccgatggcgatgattacctgggcctgcaacaag
tacagtggtgtacgtacgatcgggttgtgtcacggtgtacagcacggacatcaccaaatt
gctgaagtatatggcttggagaagcaggatgtggacattgtgtgcgccggaatcaatcac
cagacgtggtacattcaggcgtcacatgaaggcaaggatctgacagtcggactgctggag
gcttttgaacagcatcccgaatatagccgcaccgaaaaggtacgcatcgacatgcttcgc
cgttttggctattacagcaccgaatcgaacggccatctaagcgagtatgttccctggtac
cggaagcgtccggatgaaattctcgactggattgatctgggaagctggatcaacggagaa
acgggaggctatctgcgtgtatgtacagaaggacgcaactggtttgaaacagattttcca
aactggatgaaggaagacccattggtatacaaggctgagaatcgtggtgaggagcatggc
tcctacattatcgaaggactggaaacaggacgtgtataccgggggcattttaatgtcgtc
aacaacggagtgatttccaatctgccggatgatgcgattattgaggcgcccggatatgtg
gatcgtaacggcatttccatgcctcatgtgggtgaactgccgctcggtcctgcggctgtc
tgcaatgttagcatttccgtgcagcgtttggcagttgaagctgccgtgcatggggacgac
aagctgttgcggcaggcgttcatgatggacccactggtgggtgcggtatgtaatccgaag
gaaatctggcaaatggtcgatgaaatgctggtagcgcaggaagcgtggcttccacaatac
ggagcggcaattgccgaggcgcgccaacgtttagctgagggcgatctgatcccaactcgt
gcttatgagggagcggcaaggcttaaggtcaagacgattgaggaaatgcagttggatcgg
gaggcggccaataaaaatgcgggcgaatccgacaaaggcaaggaacgtgaaaaggtggag
cccagcaaggtctag

DBGET integrated database retrieval system