KEGG   Paenibacillus terrae: HPL003_15115Help
Entry
HPL003_15115      CDS       T01668                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pta  Paenibacillus terrae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPL003_15115
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HPL003_15115
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPL003_15115
Enzymes [BR:pta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     HPL003_15115
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPL003_15115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3248393..3249706
Genome map
AA seq 437 aa AA seqDB search
MKKRSMKKSILALGAITVLGAPLLSADIPTTFAASSNSKSTTAQVSKAQKSTSVKVDAPK
NVILFIGDGMGQASRNAVRLATVGKSGLLEMDNMPVTGLVSTSSGDNLVTDSAAAATAIA
TGVKTYNGAIGMDMNKKPVTTIMELAKKAGMSTGVVTTSQVTDATGAAFGAHVEKRSAQS
EIAKQYLENSKLDVILGGGEDFWYPAGTAGKHPDAPAEDPEEASKGTQGNLVDQAKKSGY
SYVTDQAEMKAAKGSKLLGLFANEEMFQAHNKLGNAYNPTVSLPDMTTKAIDVLSKNQKG
FFLMVEEEGTDEMAHDNEGALTIKAGQQLDKAVKVAKDYAKAHPDTLVLVTADHETGGLA
IEGKDAKDEADDGTTNEDGPFTIQGTNETFYIDWTTKGHTAVDVALTAMGPGASQFSGNY
PNTAIHDKLVKLLKLKK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagcgttcaatgaaaaagagtattcttgctttaggcgctattacggtcttgggt
gcgccattgttatctgctgacatccctaccacttttgcagcctcatctaattcgaagtcc
actacagcacaagtgtccaaagcacagaagtctacctcagtaaaagtcgatgctcctaaa
aatgtcattctttttatcggcgatggcatgggacaagcaagccgcaatgcggttcgtctg
gcaacagtcgggaagtcgggattgcttgaaatggataacatgcctgtaacggggctggtt
agcacaagctcaggggacaacctcgttacagattccgccgccgccgcaactgccattgca
acaggtgtaaaaacgtataacggcgctatcgggatggatatgaataaaaagcccgtcaca
acgatcatggagctggcgaaaaaagctggcatgtccacaggtgtcgtgacgaccagccaa
gtgacggatgcaaccggggcagccttcggtgcgcatgtcgagaagcgctctgcgcaaagc
gaaattgctaagcagtatctggagaatagcaagctggatgtaattctgggtggtggtgag
gatttctggtatccggcaggaacagcaggtaaacatccagatgcgccggcagaagatccc
gaggaggctagtaagggaactcaagggaatttagtggaccaggccaagaaatcgggctat
agctatgtgacggatcaggcggaaatgaaagcagccaaaggctctaaactgctcgggttg
ttcgccaatgaagagatgttccaagctcataataagctgggtaacgcttataacccaacc
gtttctttgccagatatgacgacgaaagcgattgatgtgctatccaaaaaccaaaaaggc
tttttcctgatggtagaggaagaaggaacggatgagatggcgcatgacaatgaaggtgca
ttaacgatcaaggccgggcagcagctcgacaaggccgttaaagtagctaaagattatgcc
aaagcgcatccagatacactggttctggttacagctgaccacgaaacgggtggtttggcc
attgaaggcaaggatgcgaaagacgaagccgacgacggcaccacgaatgaagatggtcca
ttcaccatacaaggcacgaacgaaacgttttatattgattggacgacaaaaggacatacc
gcagtagatgtggcactgactgcgatgggacctggcgcctcccaatttagcggaaattac
ccgaataccgctattcatgacaagctggttaagctgcttaaattgaaaaaataa

DBGET integrated database retrieval system