KEGG   Paenibacillus terrae: HPL003_15380Help
Entry
HPL003_15380      CDS       T01668                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pta  Paenibacillus terrae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_15380
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPL003_15380
  Amino acid metabolism
   00310 Lysine degradation
    HPL003_15380
Enzymes [BR:pta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HPL003_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3302928..3304241
Genome map
AA seq 437 aa AA seqDB search
MSDILVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGETVVIGEAVGLIGSGSGSVSAGSSGAGEAAATKAPEAPPVATSPASIEGGGKSAAEQ
AAQPIPSHGDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHANSADVSRA
ASPAPAAPAANKPAAASPSQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVD
MTAILDVRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDI
GIAVSAKEGLVVPVVRDADRLGFAEIEKSIADLAGKARSNSLSLADLQGGTFTITNGGIF
GSLLSTPILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFL
VTVKELLEDPESLLLEG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatattttagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtgaaggaaggggattccgtaggacaaggggatgttctactggagctggaaacc
gataaggtcaatctggaaattagcgcagaggaagcgggcgtagtccagaaaatccttcgt
caggaaggggaaacggtggttattggtgaagctgtaggtttgatcggaagcggcagtggg
agcgttagcgcaggatcatccggtgccggagaagcagcagcgaccaaagcgccggaggca
ccgcctgtagccacttcgcctgcttccatagaaggcggtggcaaatcagcagcggaacag
gccgcacagcctattccgtcccacggtgacgggaacggtcagacggcatctccatctgcc
cggaagctggcgcgtgagcgcggaattgatctggagcaggtacaggggaaggacccgctc
ggacgcgtgttccaggaggacgttaaaacgcatgcgaacagcgccgatgtttcgcgtgct
gcatcacctgcacctgccgctcccgctgcgaataagcctgctgctgcgtctccgtctcag
acagagtacagcaagccggtagaacgtcagcgcatgtcccgccgcagagcgaccattgcc
aaacgtctcgttgaggcacagcaaacggcagctatgcttacgacctttaatgaagtggat
atgaccgccatccttgatgttcgcaaacgccgcaaagataagttcaaggagaagcatgat
gttggcttgggctttatgtccttctttacgaaggcagtggttggcgcgctcaagcgattc
cctaccgtgaatgcggaaattaacggcgatgatatcgtactgaaaaaatactatgatatc
gggattgccgtatctgcaaaggaagggctggtcgtacccgttgtacgggatgctgatcgt
ctcggctttgccgaaatcgagaagagcattgcagatttggctggcaaagcacgttccaat
tcgctttctctggcagatctgcaagggggaacctttaccattaccaacggaggtattttc
ggttccctgctgtctacgccaatcctgaatacaccgcaagtgggtattttgggaatgcat
aaaatccagcttcgcccgattgccattgacgaggaacgtatggaaaatcgtccgatgatg
tatatcgcgttgtcctacgatcaccggattattgatggcagcgaagcggttcgcttcctg
gtaacggtcaaagaattgctggaagatccagaatcgctgttgctggaaggataa

DBGET integrated database retrieval system