KEGG   Paenibacillus terrae: HPL003_16720Help
Entry
HPL003_16720      CDS       T01668                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pta  Paenibacillus terrae
Brite
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     HPL003_16720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3588445..3589467
Genome map
AA seq 340 aa AA seqDB search
MNLSTRKEASLKELYKDDYQIGAAVNPLTIEIQKSLLAYHFNSITAENEMKFSSLHPEEE
VYTFENADRLAAFAKEHGMAMRGHTLVWHNQTPDWLFENEQGGPADRALLLERLRSHIQT
VVGRYKDTVYCWDVVNEVISDEESDKEAFLRPSKWLDIAGPDFIAKAFEYAHEADPKALL
FYNDYNESHPYKRDRIHRLVRSLLDQGVPIHGVGLQAHWNLFDPSLDDIRAAIEKYAELG
LQLQLTELDLSVFRFDDRRTDLLHPSNEMLERQAELYEAVFRLLREYRDCISAVTFWGAA
DDYTWLDGFPVRGRKNWPFLFDQSHRPKQAYERVAALANR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatcgacgcggaaagaagcttcattaaaagaattatacaaagacgattaccag
atcggagcggcggtcaatcctctaaccattgagattcagaaatcgttgcttgcttaccac
tttaacagtattacagcggaaaatgaaatgaagttctcaagcttgcatccagaggaggag
gtgtatacctttgagaatgccgaccgactagctgcatttgccaaggagcatgggatggca
atgcgcggtcacaccctggtctggcataatcaaacgccggattggctgtttgagaatgaa
caaggcggtccagcggatcgtgccttgctgctggagcggctccgttcgcatatccaaacg
gtagttggacggtataaggatactgtatactgctgggatgtggtgaatgaggtcatctcg
gacgaggagtcagacaaggaggcgttccttcgcccgtcgaaatggctggacatcgccgga
cctgattttatcgccaaggcttttgaatatgcgcatgaagcagatcctaaggctctgcta
ttctacaacgactataatgagtcccatccttacaagcgggatcgtatccatcggctggtc
cggtcgctgttggatcagggagtgccgattcacggcgttggcctccaggcgcattggaat
ctgttcgatccttccctggacgacatccgtgcagccattgaaaaatatgcagagctggga
cttcagctccaactgacggaactggacctgtcggtcttccgcttcgatgacagacgtacc
gacctgcttcatccttcgaatgaaatgctggaacggcaagcagagctttacgaggcggtt
ttccgtctgctgcgggaataccgcgactgtatcagtgcagtcacattctggggggctgcc
gacgattatacctggctggacggctttccagtcagaggccggaagaactggcctttttta
ttcgatcaatcgcatcgtccgaagcaagcctatgagcgtgttgctgcactggcgaaccgt
tga

DBGET integrated database retrieval system