KEGG   Paenibacillus terrae: HPL003_16875Help
Entry
HPL003_16875      CDS       T01668                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pta  Paenibacillus terrae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HPL003_16875
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HPL003_16875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3619380..3620825
Genome map
AA seq 481 aa AA seqDB search
MEQKLRNIVIVGGGLTGLSTAFYTRKMYKEAGYTPRITLVEKAPVLGGKIETLHKDGFVI
EKGPDSFLARKTAMIDLAKELELDHELVSTNPEAKKTYILHEGQLHPMPPGLVLGIPTEL
KPFLRSGLISLGGKLRAMMDFVIQPRRVSGDEALGDFIERRLGKEVLENITEPLLAGIYA
ANMKTLSLQATFPQFAEVEQQYGSLIHGMMTGRKPAETHTGTKKSVFLTFRQGLQSLVHA
LLDDLRDCDLRRGVAVTEFTKTADGEGSVYHVVLDNGETLEADDLFITTPNFAAAPLLRG
HVNVAALEAVNYVSVANVVMAFNKKDIENVFDGSGFLVPRKEGRSVTACTWTSAKWLHTS
PDDKVLLRCYVGRAGAEETVELPDDELTALVRKDLQDMMGITATPLFTEITRLRHSMPQY
PVGHPQAIADLREELRTTMPGVYVLGAGYDAIGLPDCIRQAKEWASVAVQAAEREAVEVQ
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaaattacgcaacattgtgattgtaggcggaggattgaccggactaagcaca
gctttttatacacgtaaaatgtacaaagaagcaggttacacaccgcggattacgctggtg
gagaaggccccggtgctgggcggtaaaatcgaaacgttgcataaagacgggtttgtgatt
gaaaaagggccggattcctttctggcccgtaaaacggctatgatcgacctggcgaaagag
ctggagctggatcatgagctggtaagcacgaatcctgaggcgaaaaaaacatacattttg
catgaaggtcagcttcatccgatgcctcccggtctggtactggggattccgacggagctg
aaaccgtttctgcgcagcggattgatctcgttgggcggcaagctgcgggccatgatggat
tttgttattcagccccgtcgcgtatcgggtgatgaagccttgggagattttattgaacgc
cgactgggcaaagaagtgctggaaaatataaccgagccactgctggctggcatatatgct
gccaatatgaagacgctgagtttgcaagcgaccttcccgcaatttgctgaagtagagcag
caatacgggagcctcattcacgggatgatgaccggaagaaaaccggcagagacgcataca
ggtacgaaaaaaagtgtctttttgaccttccgccaagggctgcaaagtttggttcatgcg
ttactggatgacttgcgtgactgtgatttgcgcagaggcgttgctgttacagaattcaca
aagacagcagacggtgaaggaagcgtctaccatgttgtactggataatggtgagacgttg
gaggcggacgatctatttatcacaactccgaattttgccgctgcgccgctgttgcgggga
catgtgaatgtggcggcactggaagccgttaattatgtatccgtggcaaatgtggtcatg
gcctttaataaaaaagacatcgagaatgtctttgatggttccggttttctggttccgcgt
aaagaggggcgcagtgtgacggcatgtacgtggacgtctgccaagtggctgcataccagt
ccggatgataaggtactactgcgctgttatgtggggcgtgccggagccgaagaaacggta
gagctacccgatgatgaactgactgcgctggtgcgtaaggatttgcaggacatgatgggc
attacggcgactccgctatttacggaaattacccgtcttcgccactccatgccgcaatac
ccggtaggacacccgcaggctatcgccgatctgcgggaagaactgcgcacaacgatgccg
ggagtatatgttttgggtgcaggctatgatgccatcggcttgccggattgtatccgtcag
gccaaggaatgggcctctgtcgccgtccaagctgcggaacgggaagcagtcgaggtacag
gtataa

DBGET integrated database retrieval system