KEGG   Paenibacillus terrae: HPL003_16965Help
Entry
HPL003_16965      CDS       T01668                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_16965
   01230 Biosynthesis of amino acids
    HPL003_16965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_16965
   00030 Pentose phosphate pathway
    HPL003_16965
   00051 Fructose and mannose metabolism
    HPL003_16965
   00052 Galactose metabolism
    HPL003_16965
  Energy metabolism
   00680 Methane metabolism
    HPL003_16965
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HPL003_16965
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HPL003_16965
Protein phosphatases and associated proteins [BR:pta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HPL003_16965
Messenger RNA biogenesis [BR:pta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HPL003_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3635632..3636603
Genome map
AA seq 323 aa AA seqDB search
MTAIKKIAVLTSGGDSQGMNAAVRAVVRSGLYFGLEVFGVQRGYQGLLNDDIFPMDLRSV
GDIIQRGGTVLQSARCKEFTTEEGQKRGAEILRNRGIDGVVVIGGDGSYQGANKLTKQGI
KTMCLPGTIDNDISFTDYTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIA
LHAGLASGAETILVPEVEFDLNEVSDRMKQNFKHGKRHSIIIVAEGAGKGETVAQVIQEN
CPDYEPRVTVLGHIQRGGTPTAFDRNLASRLGDFAVRQLIEGVSDKACGTIDGKLVATDI
DKVVNTKKEFNMELYELALRLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaattaagaaaatcgcagtattaacgagtggtggagattcacaggggatgaat
gccgcagttcgcgccgttgtgcgtagcggcttgtattttggacttgaagtattcggggtt
cagcgcggatatcaaggcctgctgaatgatgatattttcccgatggatttgagaagtgtt
ggagatattatccaacgtgggggtactgtacttcaatctgcaagatgcaaggaatttacg
accgaggaaggacagaagcgtggcgctgaaattttgcgtaaccgcggaattgatggtgta
gtcgtgatcggtggcgacggttcctatcaaggggctaacaaactgaccaagcaaggaatt
aaaaccatgtgtcttccgggtacgattgacaatgacatttccttcaccgactatacgatt
ggttttgacacggcggttagtatcgtagtggacgccatcaacaagctgcgtgatacgatg
tcatcccacgaacgttcttctatcgtagaagttatgggacgtcattgcggcgatattgct
ttgcatgcaggtctggcttccggcgcggaaacgattttggtacccgaggtagagtttgac
ctgaatgaagtatctgatcggatgaagcaaaactttaagcacggcaaacgccatagtatc
attattgttgctgaaggtgcaggtaaaggtgaaaccgtagcacaggtaatccaagaaaac
tgtccggactatgagccgcgtgttacggtgcttggacatatccagcgtggagggacacca
actgcatttgaccgtaatctggcgagccgtttgggtgactttgctgttcgtcaattgatt
gagggcgtatctgacaaggcttgtggaacgattgatggcaagctggtagccacagatatt
gacaaggtcgtaaatacgaaaaaagaattcaatatggagctttacgagctggccttgcgc
ttgtcccagtaa

DBGET integrated database retrieval system