KEGG   Paenibacillus terrae: HPL003_18080Help
Entry
HPL003_18080      CDS       T01668                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta (SCS-beta)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pta  Paenibacillus terrae
Pathway
pta00020  Citrate cycle (TCA cycle)
pta00640  Propanoate metabolism
pta00660  C5-Branched dibasic acid metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Module
pta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HPL003_18080
   00640 Propanoate metabolism
    HPL003_18080
   00660 C5-Branched dibasic acid metabolism
    HPL003_18080
Enzymes [BR:pta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HPL003_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AET60358
UniProt: G7W2L3
Position
3852360..3853520
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEVLKQYGVAVPNGKVAYTVEEAVAAAESLGSAVTVVKAQIHAGGRGKAGGV
KVAKSLDEVRTYASEILGKVLVTHQTGPEGKEVKRLLVEEGCDIRKEYYVGVVVDRATGR
VVIMASEEGGTEIEEVAAATPEKIFKAVVDPAIGLQVYQARKLAYDINIPNELVNKAVKF
MQALYEAFVDKDCSIAEINPLVVTGDGNVLALDAKLNFDSNALFRHKDILELRDLDEEDE
KEIEASKYDLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGDPANFLDVGGGATTEKVTE
AFKIILSDPKVEGIFVNIFGGIMQCDIIANGVVEAAKQLGLTRPLVVRLEGTNVELGKQI
LAESGLNIVAADSMADGAQKIVELVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgaatatcagggtaaagaagtattgaagcagtacggagtggctgtaccg
aacggtaaggttgcctatacggtggaggaagccgtcgctgcagcagaatcgcttggaagc
gctgttacggtggtaaaggcgcaaattcatgcaggtggacgtggtaaagcgggcggtgtg
aaggtggccaaaagcttggatgaagttcgtacttatgcttctgaaattttgggtaaggtg
ctggtgacacatcagaccgggcccgaaggcaaagaggttaaacgccttttggtagaggaa
ggctgcgatattcgtaaagagtattacgtcggtgttgtcgtggatcgtgcgaccggacgt
gtcgtgatcatggcctcggaagaaggcggtacggaaatcgaagaggtagctgcggctact
ccggagaaaatttttaaagcggttgttgatccggcgattgggcttcaggtatatcaggcg
cgcaaactggcgtatgacattaacatcccgaatgagctggtgaacaaggcggttaagttc
atgcaggcgctctatgaagcttttgtggacaaggattgttcgattgcagagatcaatccg
ttggtcgtcacaggtgacgggaatgtgctggcattggatgccaaactgaattttgactct
aatgcgttgttccgccacaaggatattttggaactgcgtgatttggacgaagaggatgag
aaggaaatagaagcttccaaatacgatctgagctacatcgcattggacggaaatattggt
tgtatggtcaacggcgcaggtcttgcaatggcgacgatggacattatcaaatattacggc
ggcgatccggccaacttcctggacgtagggggcggtgcgacgacagaaaaggtaaccgaa
gcgtttaaaatcattttgtccgatccgaaggtagaaggcatttttgtgaacattttcggc
ggaattatgcaatgtgatatcattgcgaacggtgtggtggaggctgccaagcaattgggg
ctgacacgtccgcttgttgtccgtctcgaaggtacgaatgtcgagttgggtaaacagatt
ttggcggaatccggtttgaatatcgtggcggctgattccatggcggacggtgcccagaaa
atcgtcgaacttgttcaatag

DBGET integrated database retrieval system