KEGG   Paenibacillus terrae: HPL003_18250Help
Entry
HPL003_18250      CDS       T01668                                 

Definition
chemotaxis protein CheY
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pta  Paenibacillus terrae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pta00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPL003_18250
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HPL003_18250
Enzymes [BR:pta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HPL003_18250
Two-component system [BR:pta02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   HPL003_18250
Bacterial motility proteins [BR:pta02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HPL003_18250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3884249..3885802
Genome map
AA seq 517 aa AA seqDB search
MCAYRVLVVDDSAFMRKIVSDLIVRDDSFDIVGTAANGKEAVEKVKELQPDLVTMDVEMP
EMNGLEALPLIMAAHPLPVIMLSGINEQGMKETIMALEAGAFDFIRKPSVSHTQDIQQVG
KALLEQMHTAMQAVRSRLERKEANERKAALEQAKKTPLEQTSEGQAVADKGVEGKAPTGN
TPIAPIASATAAPVPPKRDTGKSVPVAKPEQKQPQTGSSVTDSRLSKPVAQPRKTAQAPA
TQKKEPPKATERTPGQLNISDTVAAKSLHGADKGGLSKPEPRKTVSTPVPSAPVAPMAAT
PPVTAPIVPAATKGFSLKKGGVYSSNFRKLVAVGCSTGGPRALKTLLEHIPGDFPAPIVI
VQHMPPNFTRSLAQRLNTLSPLRVVEAEQGMTLEAGTAYIAPGGYQLRIVPGASGKYTVS
LKTEEARNGHRPSVDTMFESLLPLTSLERHLVLLTGMGSDGAKMMKKLYDAGVQSTFAEN
EETCVVYGMPRSAVELKCVRHLLPMQEIAPKLVQVVK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcttaccgggtgctggttgtggatgattcggcctttatgcgcaaaattgtttca
gatttaattgtaagggatgattcgttcgacatcgtaggtacagccgccaacggcaaagag
gctgtagagaaagtgaaggagctacagcctgatctggtcacaatggatgtcgagatgcct
gaaatgaatggccttgaagcgctccctctgattatggcggctcatcctcttccggtcatt
atgctctctggtattaatgaacaaggtatgaaggagaccattatggctctggaagcagga
gctttcgattttatacggaagccctccgtctctcatactcaggatatccagcaggtgggc
aaggcgttattggagcagatgcacaccgctatgcaagcagtccgcagccgtttggagcgc
aaggaagctaacgaacgaaaagcggcgctggagcaagcgaaaaaaacgccgctggagcag
acttcagaaggacaagctgtggctgataagggagtggaaggtaaagcacctacaggtaat
actcctattgcaccgattgcttctgcaactgctgcaccggttccgccgaagcgggacact
ggcaagtctgttccggtagccaagccggaacagaaacagccacagacaggcagctctgtg
actgacagccgtttaagtaagccagtcgcccagccacggaagacggcgcaagcacctgct
acgcagaagaaggagccgcctaaggcaactgaacgtactccagggcaactgaatatttcc
gatacggttgcagccaaatcgctgcacggcgcggataagggagggctaagcaagccggag
cctcgaaaaacggtgtctacgccagttccttcggctccagttgctcctatggctgctacg
cctccagtgacggcaccaatagttccagcagcgactaaggggttctctcttaaaaaagga
ggagtatattcgtccaactttcgcaagctggtggcggtcggatgttctacaggggggccg
cgtgcgctcaagacgttgctggaacacattcctggggattttcccgctccgattgtcatc
gtgcagcatatgccgccaaactttacccgttcgctggcacagcgtctgaatacgttgagt
ccgctccgggtggttgaagctgagcaggggatgacgttggaggccggaacagcttatatt
gctcctggaggatatcaattgagaattgtgccaggggccagtggtaaatacaccgtatca
ctgaagacggaagaagctcgtaacggtcaccgtccttctgttgatacgatgtttgaatcg
ttactcccgttaacctctctggaacggcatcttgtgttgctgactggcatggggagcgac
ggggctaaaatgatgaaaaagctttatgatgcaggggtacaatccacatttgctgaaaat
gaggaaacttgcgtagtgtacggaatgccccgctcggctgtagagttaaaatgtgtgcgc
caccttctgccgatgcaggagatcgcccccaagcttgtacaagttgtgaaataa

DBGET integrated database retrieval system