KEGG   Paenibacillus terrae: HPL003_20400Help
Entry
HPL003_20400      CDS       T01668                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pta  Paenibacillus terrae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pta00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4385719..4387641
Genome map
AA seq 640 aa AA seqDB search
MTDQTLPQQAVSPEDIYLFHEGTLYQSYRSLGSRLTVENGEQGVRFTVWAPHALHVGLAT
DRNNWNGEQDSLYRVPESGFWSRFFSGISQGTFYKYDITGANGERFLKADPYAVCAELRP
ATASVVASLEGYIWNDAAWRRKRREPYGKPLHIYELHLGTWKQKEDGTFYTYKEMAELLV
PYVTEMGYTHIELMPLSEHPYDLSWGYQLTGYFALTSRYGEPHDFMYLVDRCHQAGIGVL
MDWVPAHFAKDAHGLRLFDGSPLFEYADSLIAEKPGWGTLTFDYSKPEVRSFLISNALFW
MDVYHIDGLRVDAVTSMLRLDFEKQDGQYRFNSKGGIENEEAIAFLQQLNETVFRYYPYA
LMMAEESSAWPMVTSPVSDGGLGFNYKWNMGWMNDTLDYIETDFDQRPERHNLLTFPIAY
AYSENFTLPLSHDEVVHGKKSLLDKMPGSYEQKFAGLRALLGYQITSPGKKLLFMGGEFG
QFIEWKDEEQLDWFLLDYDSHRSLHAFTKALNHLYIQEKALWELDHSWDGYQWIEAEDRG
QSVITYLRKGKRPGDTLVVLINFQPVSRENYRIGLEKAGSYIELLNSDHSDFGGSGQLNT
EVLRTAKVPCHGQLHSLELTIPPLSVVILKKAPRRAKKAD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccaaactctcccgcaacaggctgtatcgccggaagacatttatttgtttcac
gaaggaacactttatcaaagctaccgatctttgggttcccgccttactgtggagaacgga
gaacagggcgtccgttttacggtctgggctcctcatgctctccatgtcgggcttgctaca
gatcgtaacaactggaatggggaacaggattccttatatagagttcccgaatctggcttt
tggagtcgttttttttcgggtatatcccaaggaactttttacaaatatgatattacgggt
gcaaacggtgaacgttttctaaaagcagacccttatgcagtatgcgcagaattaagacca
gcaacggcttccgtggtcgcttcactggagggctacatttggaatgacgcggcttggcgg
cgtaaacgaagagagccttatggaaagccccttcatatatatgagctgcatttgggcacc
tggaaacaaaaagaagacggtacgttttatacatacaaggaaatggctgagcttcttgtg
ccctatgtaacggaaatgggttacacgcatattgagcttatgccactcagtgagcatccg
tatgatctttcctggggataccagctcaccggatattttgcactgacaagccgttatggg
gaaccgcatgattttatgtatttggtggatcgttgtcatcaggcgggcattggggtgctt
atggattgggttccggctcattttgccaaggatgctcatggtttgagactgtttgatgga
tcgccgctgttcgaatatgcggactcgctgattgcagaaaagcctggttgggggacgctg
acgttcgattacagcaagcctgaggtgcgttctttcctgatatccaatgcgctgttctgg
atggatgtgtaccacattgacggcctgcgcgtagatgctgtgacgagtatgctgcggctg
gattttgaaaagcaggacggtcaatatcgttttaattccaagggaggcattgaaaatgag
gaggctattgccttcctccaacaactgaatgaaacagtattccgctattatccgtatgcg
ctgatgatggcagaggagtccagtgcctggccgatggtgacctccccggtaagcgatgga
ggactcggttttaattacaaatggaatatgggctggatgaacgatacgcttgattatatc
gaaacggacttcgatcaaaggcctgagcgccataatttgctgacgttccccatagcctat
gcatacagcgagaattttacactgccgttgtcgcacgatgaggtcgttcatggtaaaaag
tcgctgcttgataaaatgccgggtagctatgagcaaaaatttgccggacttcgagcgctt
cttggttaccaaatcacctcaccgggcaaaaagctgttatttatgggaggggaattcggc
caatttattgaatggaaggatgaggagcagcttgactggtttttgctggattatgacagt
caccgttcgctgcacgcttttacgaaagcgctgaatcatttgtatatacaggaaaaagca
ttatgggagctggatcattcgtgggatggttatcagtggattgaggcggaggaccgtggg
cagagcgtaattacgtatttacgtaaagggaaaaggccaggagatacactggtcgtgctt
attaactttcagcccgtgtcaagagagaactaccgaattggtctggaaaaggccgggagc
tatatcgaactgctgaacagtgatcattcagactttggcggtagtggccagttgaacacc
gaagtgttgcgcacagccaaggttccttgccacggacaactccacagcttggagctgacc
attccgccgctgagcgtcgttatactgaagaaagcgccccgaagggctaaaaaagcagat
taa

DBGET integrated database retrieval system