KEGG   Paenibacillus terrae: HPL003_21840Help
Entry
HPL003_21840      CDS       T01668                                 

Definition
alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pta  Paenibacillus terrae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HPL003_21840
  Lipid metabolism
   00561 Glycerolipid metabolism
    HPL003_21840
   00600 Sphingolipid metabolism
    HPL003_21840
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HPL003_21840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4703961..4705346)
Genome map
AA seq 461 aa AA seqDB search
MKKMKVALIGAGSVSFALGALQDMVLSERLKTQVELEIALMDIEEENVARTYKYATDMFT
AFSHPANIWQTTNLEAALQAADFVIVAIEVNRYFYWSQDFHIPRRFGSKQIYGENGGPGS
MFHTLRNLGPMLEIARTMERVCPDAWFINYTNPEAKLVEAISKLTSVKVVGLCHGLDMGI
EQLSQFLEMDIADIGMEGGGLNHFGFFTKIWNKKTGEDLYPLFDEKERKANRLAQFEHVA
LSRTMYRTYGYYPYPGTNHVGEYITYAEDFYVGLSLQYRYDPIREKLWEKDSRTPEFVYS
ASGNNLDQGLFSKIQTQELWVEEAYIFDKSKVCRSNEYAVPIIEAIFFDDEIELNAVNLP
NYGAIKGLPDDMVVETQAIVNGKGITLKPMTVELPTALIGTIHIQGTIHKLLLEAFVEQS
KTKLLQAILLDPQAPTYYQACAMIDEICKLQQDILPKLDWK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgaaagttgcgttaattggagccggcagcgtttcctttgctctgggagca
cttcaggatatggtgctgtccgagcggttgaaaactcaggttgagctggagatcgcactg
atggacattgaagaagagaatgtggcaagaacctataaatatgcaacagatatgtttacc
gccttctcgcatccggcgaacatttggcagacgaccaacttggaagcggctctgcaggcg
gccgatttcgttatcgtggcgattgaggtaaatcgctacttctattggtcgcaggatttc
catattcctcgccgcttcggcagtaagcaaatttacggtgagaacggcggtcctggctcg
atgttccatacactgcgaaatctgggtccgatgctcgaaatcgcccgcacgatggaacgt
gtctgcccagacgcctggttcattaactatacgaatcctgaagcgaaattggttgaggct
atctcgaagctaacctcggtcaaagttgtaggtctatgccatggactggatatggggatc
gagcagctgtcccaattcctggagatggatatcgcagatatcggaatggaaggcggtggc
ttgaaccacttcggtttcttcaccaagatctggaacaagaaaacaggtgaggatctgtat
ccgttatttgatgagaaggagcggaaggccaaccgtctggcgcaattcgaacatgtcgcg
ctatctagaacgatgtaccgcacttatggatattacccttatccaggcaccaaccatgtg
ggtgaatatatcacatatgcagaggatttctatgtgggcttgtccctgcaataccgctat
gatccaattcgcgagaagctgtgggagaaagattccagaacccctgagttcgtatacagt
gcaagcggcaacaatctggatcaaggcttgttctcgaagattcagacgcaggagctctgg
gtggaagaggcctatatcttcgataagtcgaaggtctgccgcagcaatgaatatgcggtt
ccgatcattgaggcgattttcttcgatgatgagattgaactgaacgcggtcaatttaccg
aactacggtgcgattaagggacttcctgacgatatggttgttgagacccaggcgatcgtt
aacggcaaaggaattacgctgaagccgatgacggtagaactgccgactgcgcttatcgga
acgattcatattcagggcacgatccataaattgttgcttgaggcttttgtggagcaatcc
aagacgaagctgctgcaggcgatcttactagatcctcaggctccgacttattaccaggcc
tgcgcaatgatcgacgaaatttgcaaattgcagcaagatattttacctaagctggattgg
aaataa

DBGET integrated database retrieval system