KEGG   Paenibacillus terrae: HPL003_23345Help
Entry
HPL003_23345      CDS       T01668                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pta  Paenibacillus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPL003_23345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_23345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPL003_23345
Enzymes [BR:pta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPL003_23345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5089153..5089959)
Genome map
AA seq 268 aa AA seqDB search
MNLIDQVFGRLKNEGKTALIPFLTVGDPDVDTTVEIIRQLESAGADILELGVPYSDPLAD
GPVIQRASERALKRQISIRTCMETASLARAAGSSLPFILFTYYNPVLQMGMDAFFAGLQK
HGISGLIIPDLPLEEAEELGGRAAEVGVHLIPLVAPTSEQRIERIVRQARGFVYCVSSLG
VTGERASFFEGIEGFIAQVKRHTDIPVAVGFGISTREQVTRFSDICDGVVVGSAIVRQVE
EAIPLLDDSARREEGLLQIRNFVAQLKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattgatcaggtgtttggacgcctcaaaaatgaaggcaaaacggcattaatt
cctttcctgacggtaggcgatccggatgtggacacgacggtagaaatcatacggcaactg
gagtcggccggggccgatatattggagctgggcgttccatattcggacccgctggctgac
ggacctgtcattcagcgtgcgtctgagcgtgcgttgaaacggcaaatctcgatccgcacg
tgtatggagacggcttctttggcccgggcagcgggatcaagcctgccttttattttgttc
acgtattataatcctgtgttgcagatgggcatggatgctttctttgcaggcttgcagaag
catggcatcagcggtctgatcattcccgatcttccgcttgaggaagcagaagagctggga
ggacgggcagcagaggttggtgtgcatctgattccgttggtggctccaacttctgaacag
cggattgaacgaattgttcgtcaagcgcgcggatttgtatactgcgtatcctcccttggg
gtgaccggggaaagagcttccttttttgagggcatagagggcttcatcgcgcaggtcaag
cggcatacggatattccggtagcggttgggttcggtatttctaccagggagcaggtcacc
cgtttttcggacatctgtgatggagttgtcgtcggaagtgccattgtgcgtcaggtggag
gaagcgatcccgctgctggatgattctgcgcgcagagaagaaggacttttgcaaattcgt
aattttgtggcacaattaaagctgtaa

DBGET integrated database retrieval system