KEGG   Paenibacillus terrae: HPL003_23345Help
Entry
HPL003_23345      CDS       T01668                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pta  Paenibacillus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPL003_23345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_23345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPL003_23345
Enzymes [BR:pta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPL003_23345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5089153..5089959)
Genome map
AA seq 268 aa AA seqDB search
MNLIDQVFGRLKNEGKTALIPFLTVGDPDVDTTVEIIRQLESAGADILELGVPYSDPLAD
GPVIQRASERALKRQISIRTCMETASLARAAGSSLPFILFTYYNPVLQMGMDAFFAGLQK
HGISGLIIPDLPLEEAEELGGRAAEVGVHLIPLVAPTSEQRIERIVRQARGFVYCVSSLG
VTGERASFFEGIEGFIAQVKRHTDIPVAVGFGISTREQVTRFSDICDGVVVGSAIVRQVE
EAIPLLDDSARREEGLLQIRNFVAQLKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattgatcaggtgtttggacgcctcaaaaatgaaggcaaaacggcattaatt
cctttcctgacggtaggcgatccggatgtggacacgacggtagaaatcatacggcaactg
gagtcggccggggccgatatattggagctgggcgttccatattcggacccgctggctgac
ggacctgtcattcagcgtgcgtctgagcgtgcgttgaaacggcaaatctcgatccgcacg
tgtatggagacggcttctttggcccgggcagcgggatcaagcctgccttttattttgttc
acgtattataatcctgtgttgcagatgggcatggatgctttctttgcaggcttgcagaag
catggcatcagcggtctgatcattcccgatcttccgcttgaggaagcagaagagctggga
ggacgggcagcagaggttggtgtgcatctgattccgttggtggctccaacttctgaacag
cggattgaacgaattgttcgtcaagcgcgcggatttgtatactgcgtatcctcccttggg
gtgaccggggaaagagcttccttttttgagggcatagagggcttcatcgcgcaggtcaag
cggcatacggatattccggtagcggttgggttcggtatttctaccagggagcaggtcacc
cgtttttcggacatctgtgatggagttgtcgtcggaagtgccattgtgcgtcaggtggag
gaagcgatcccgctgctggatgattctgcgcgcagagaagaaggacttttgcaaattcgt
aattttgtggcacaattaaagctgtaa

DBGET integrated database retrieval system