KEGG   Paenibacillus terrae: HPL003_23350Help
Entry
HPL003_23350      CDS       T01668                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pta  Paenibacillus terrae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPL003_23350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_23350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPL003_23350
Enzymes [BR:pta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPL003_23350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5089956..5091152)
Genome map
AA seq 398 aa AA seqDB search
MTQLPDNNGRFGTFGGRFVPETLMNALIELEESYRKYADDPDFNAELNGLLKDYSGRETP
LYYAERLSQHLGKAKIYLKREDLNHTGAHKINNALAQGLLAKRMGKQKVIAETGAGQHGV
ATATVAALLGLECKVFMGEEDTVRQQLNVFRMQLLGAEVIPVTSGTRTLKDAGNEALRYW
VSHVHDTFYILGSAVGPHPYPMMVRNFQRVIGDETRRQILEKEGRLPDVVVAAIGGGSNA
IGMFYPFIEDHEVALLGVEAAGKGVETEFHAATMSKGTQGVFQGSMSYLLQDEYGQVQPA
HSISAGLDYPGVGPEHSYLKDIERAKYVPISDQEALDALQLLCRTEGILPALESAHAVAQ
VVKLAPTLTADDIIVICLSGRGDKDVDSIIKHLGGNPS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattacctgataacaacgggcgttttggaacatttggcggacgttttgtaccg
gaaacgttgatgaacgcactgattgaattggaggaatcctaccggaagtatgcggatgat
cctgattttaacgcagagctgaacggactgctaaaggattattcgggccgggaaacgccg
ctctattatgcggagcgtttgagtcagcatttgggcaaggctaaaatttacttgaaacgt
gaagatctgaaccataccggagcccacaaaattaataatgcgctggcgcagggactgctg
gcgaagcgtatgggcaagcagaaggtcattgccgaaacaggtgcaggccagcatggtgtt
gcgacagcgaccgtcgcggcattgctcggactggaatgcaaggtgtttatgggggaagag
gataccgtacgccagcagctaaatgtattccgtatgcaactattgggtgcagaggtcatt
ccggttacatcgggcacacgtacgctcaaggatgctgggaatgaagctttgcggtattgg
gtgagccatgtccatgatacattctatattttgggctcggcggtcggaccacatccgtat
ccaatgatggtgcgcaacttccagcgtgtcattggcgacgaaacccgccgccaaattctc
gaaaaagaaggcaggcttccagatgtcgtggtagcggcgatcggtggcggaagtaatgcc
atcggtatgttctatccttttatcgaggatcacgaggttgctttgcttggcgtcgaggcg
gctggaaaaggcgtggaaacggaatttcatgcagcaacgatgagcaagggaacgcaaggt
gtcttccaaggctctatgagctatctgcttcaggatgaatatggacaggtacagcctgcg
cattccatctcggcgggattggactatccgggggttgggccggagcattcgtatttgaag
gatattgaacgggccaagtatgttccgatttccgatcaggaagcactggatgctctccaa
ttgttatgccgcacggaaggtattctgccggcgttggagtcggcacatgcagttgcacag
gtcgttaaactggcacctaccttgacggcggatgatattattgttatctgtttgtcgggt
cgcggcgacaaagatgtggactccattattaagcatttgggaggaaatccgtcatga

DBGET integrated database retrieval system