KEGG   Paenibacillus terrae: HPL003_23360Help
Entry
HPL003_23360      CDS       T01668                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pta  Paenibacillus terrae
Pathway
pta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01130  Biosynthesis of antibiotics
pta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPL003_23360
Enzymes [BR:pta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPL003_23360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE ThiG
Motif
Other DBs
NCBI-ProteinID: AET61392
UniProt: G7VRL3
Position
complement(5091832..5092626)
Genome map
AA seq 264 aa AA seqDB search
MYLDRIVVTKRQEVEQLKEHFQISKAERLVADLSATRGFEDAIALRRNRPLGLIAEVKKA
SPSKGLIRPDFHPVDIARAYEGAGADCISVLTDVTYFQGSPEYLHQIREQVKIPLLRKDF
IIDERQIYEARLLGADAVLLIAAILEPRVLGSFLEIAKNLGLDALVEVHDSEELKAVLDL
GTATLIGVNNRNLRTFETRLQTTEELFSLIPKGVTFISESGIAGPEDVKYLHSVGAHGIL
VGEHLMRKDDVGQAVADLMDGVKA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgatcgaattgtagtgacaaagcgacaggaagtagagcagcttaaggagcat
tttcaaatcagtaaagccgaacgattggttgccgatttatctgcgacgagaggattcgag
gatgctatagctctgcgccgcaaccgtccgctcggactgattgccgaagtgaagaaggct
tccccctccaaagggttgatccggccggattttcatccggtggacattgcacgggcttat
gagggggctggagccgattgcatttctgtcttgacggatgtgacgtactttcaggggagc
cctgaatatttgcaccaaattcgtgaacaggtaaagattccactgctgcgtaaggatttt
atcattgatgaacggcaaatttatgaagctcgtctgctgggagcggatgcggtgctgttg
attgcggccatactggagccacgtgttttggggtcatttttagagattgccaaaaacctg
ggactggacgcattggtagaggtgcatgacagtgaggagcttaaagctgtgctggatctg
gggacagccaccttgattggcgtgaataaccgaaatctgcggacatttgagacccgcctc
cagacgacagaggagctgttctcactgattcctaaaggagttacgtttatcagcgaaagc
ggcattgccggacccgaagatgtgaagtatttacattcagtaggcgcacacggcatcctg
gtaggagagcatctgatgcgcaaggatgatgtaggacaggctgtagccgatttgatggac
ggggttaaagcatga

DBGET integrated database retrieval system