KEGG   Paenibacillus terrae: HPL003_23360Help
Entry
HPL003_23360      CDS       T01668                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pta  Paenibacillus terrae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPL003_23360
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPL003_23360
Enzymes [BR:pta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPL003_23360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5091832..5092626)
Genome map
AA seq 264 aa AA seqDB search
MYLDRIVVTKRQEVEQLKEHFQISKAERLVADLSATRGFEDAIALRRNRPLGLIAEVKKA
SPSKGLIRPDFHPVDIARAYEGAGADCISVLTDVTYFQGSPEYLHQIREQVKIPLLRKDF
IIDERQIYEARLLGADAVLLIAAILEPRVLGSFLEIAKNLGLDALVEVHDSEELKAVLDL
GTATLIGVNNRNLRTFETRLQTTEELFSLIPKGVTFISESGIAGPEDVKYLHSVGAHGIL
VGEHLMRKDDVGQAVADLMDGVKA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgatcgaattgtagtgacaaagcgacaggaagtagagcagcttaaggagcat
tttcaaatcagtaaagccgaacgattggttgccgatttatctgcgacgagaggattcgag
gatgctatagctctgcgccgcaaccgtccgctcggactgattgccgaagtgaagaaggct
tccccctccaaagggttgatccggccggattttcatccggtggacattgcacgggcttat
gagggggctggagccgattgcatttctgtcttgacggatgtgacgtactttcaggggagc
cctgaatatttgcaccaaattcgtgaacaggtaaagattccactgctgcgtaaggatttt
atcattgatgaacggcaaatttatgaagctcgtctgctgggagcggatgcggtgctgttg
attgcggccatactggagccacgtgttttggggtcatttttagagattgccaaaaacctg
ggactggacgcattggtagaggtgcatgacagtgaggagcttaaagctgtgctggatctg
gggacagccaccttgattggcgtgaataaccgaaatctgcggacatttgagacccgcctc
cagacgacagaggagctgttctcactgattcctaaaggagttacgtttatcagcgaaagc
ggcattgccggacccgaagatgtgaagtatttacattcagtaggcgcacacggcatcctg
gtaggagagcatctgatgcgcaaggatgatgtaggacaggctgtagccgatttgatggac
ggggttaaagcatga

DBGET integrated database retrieval system