KEGG   Paenibacillus terrae: HPL003_23690Help
Entry
HPL003_23690      CDS       T01668                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pta  Paenibacillus terrae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPL003_23690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_23690
   00020 Citrate cycle (TCA cycle)
    HPL003_23690
   00620 Pyruvate metabolism
    HPL003_23690
   00640 Propanoate metabolism
    HPL003_23690
   00650 Butanoate metabolism
    HPL003_23690
  Energy metabolism
   00680 Methane metabolism
    HPL003_23690
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPL003_23690
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPL003_23690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5154093..5156381)
Genome map
AA seq 762 aa AA seqDB search
MAKLEEELKQTGAAQVTTFESGNEMAATAAAQINYHMMGYFPITPSTEVAQYLDQMRTRG
QHDIKLVAADGEHGSAGICYGAAAAGARVVNATSSQGFLYMLEQLPVQSGTRFPMVMNLV
TRAISGPLDIRGDHSDLYYGLNTGWVILTASTPQAVYDMNIMALKIAEHSDVRLPVMVAY
DGFYTSHQKRKVQYFADAETVRGFVGPNPNLNYPNISDFDHPVTVGAHMNGDDLTNNHAQ
LSEALKLSEGVYEQVAAEYAALSGREYPILDLYHMEDAEVAIFLLNSAAESAKDVADQLR
ARGIKAGVIRPNIIRPFPAAQLREALRHVKALLVGERADSYGADGGNLTHEIKAALQEDP
LNRTLVLCRIFGLGGKDFYAEDAEAFFQLAIEAAEAGRTEKPFDYYGLNPGSPDKVMPQV
MQPPRGDAYRTGLIQVTPDETTGKLKVKVPPLRSLTTKPRRLTPGHGACPGCGALSALEL
FFKGIEGDIVVLFQTGCVYVVTTGYPYTSHKQPMIHNLFQNGAATLSGALEAYMEMKRRN
EIEMADDPTFIMISGDGGMDIGMGSAIGAALRNHKLIMLEYDNEGYMNTGSQQSYSTPVG
HMTSTSGVGKMQKGKQGHHKDTVQIMAACNIPYAFTAAESHPQDMLRKAAKAQWYANNVG
TAYGKILCACPLNWKSEDRLGTSIVGAAVESCFFPLYEIEQGSTTITYNPEDKGKRIPAA
EWLKLMGKTKHLLKEEATLATFEQEIERRWSILKKKHEISEL
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactggaggaagagctcaagcagactggcgccgcacaggtgacgacgttcgaa
tccggcaatgaaatggcggctacggcggctgcgcagatcaattatcatatgatgggatat
tttccgatcacaccgtcgaccgaggtggcgcaatatctggatcagatgagaacgagaggt
cagcatgacattaagctggtcgcggcggatggtgagcatggatcggcagggatatgctat
ggtgctgcggcagcgggagcgagggttgtgaacgcgacaagttcgcaaggcttcctgtat
atgctggagcagttgccagtgcagtccggtactcgttttcctatggttatgaatctggtg
acccgggctattagtggcccgctggatatccgtggggatcattcggacttgtattatgga
ctgaatacgggctgggtcattttgaccgcaagcacgccgcaggctgtgtatgatatgaac
attatggcgctgaaaatcgcagagcacagcgatgtccggctgcctgtgatggtcgcttat
gacggtttttacacgtcccatcagaagcgtaaggtgcaatattttgccgatgccgaaacc
gtgcgcggttttgtgggaccgaacccgaatctgaattatccgaatatttccgattttgac
catccggttactgtcggggcgcatatgaatggcgatgacctgacgaataatcatgctcag
ttatccgaggcgttaaagctttcagaaggagtatatgagcaggttgccgcagaatatgcc
gctttatccgggcgggaatatccgattttggatctctatcatatggaggatgccgaggtt
gcaatattcctgctgaattcggcggctgaatcggctaaggatgtagccgatcagctccgc
gcgcgcggcattaaggccggtgtgattcgtccgaatatcattcggccgtttccggctgcg
cagctgcgtgaggcattgcgccatgtcaaggcgctgctggtgggtgaacgtgcggattcg
tacggcgccgatggcggtaatttgacgcacgaaatcaaggcggccttgcaggaggacccg
ctgaaccggacgcttgtattgtgccgcatctttggcttgggcggcaaggatttttatgcg
gaagacgctgaggcattcttccagcttgcgattgaggcggcggaagccggacggaccgag
aagccttttgattactatgggcttaatccggggtccccggacaaggtcatgccgcaggtt
atgcagccgccacggggcgatgcgtaccgtacgggtctgattcaggttacgccggatgag
acgaccgggaagctcaaggtcaaggtgccgccgttacgttcactcacgaccaaaccacgc
cgtctcacgccgggtcatggggcgtgtccgggctgtggagcgttgtctgcgctggagctg
tttttcaaaggcatcgagggcgatatcgtcgtgctgttccaaacaggctgcgtatacgtg
gtgacgacaggttatccgtatacatcacataagcagccaatgattcataatctttttcaa
aatggggctgccacgctctctggagcgctggaggcttacatggagatgaagcgccgcaat
gagatcgagatggcggatgatccgacctttattatgatcagtggtgacggcgggatggat
atcggcatgggctcggctattggggctgctcttcgcaatcataagttgatcatgctggaa
tatgataacgaggggtacatgaatacaggctcgcagcaatcgtactcgactccggtcggt
catatgacaagcacgtcaggtgtagggaagatgcaaaaaggcaaacagggccaccacaag
gatacggtgcaaattatggcagcctgcaacattccatatgccttcacggcagccgaaagc
catccgcaggatatgctgcgtaaagcggccaaggcacaatggtatgccaataacgtgggt
acggcctatggtaaaatcctctgcgcctgtccgctgaactggaaatccgaggatagactg
ggtaccagcattgtaggtgccgctgtggaatcttgcttcttcccgttgtacgagattgag
caaggcagtacgacgattacgtacaatccggaggacaagggaaaacggattccagccgcg
gaatggctcaaattaatgggcaaaacgaaacatcttctcaaggaggaagccacgctggct
acctttgagcaggagattgagcgccgctggagtatcctgaaaaagaaacatgaaatttcg
gagctataa

DBGET integrated database retrieval system