KEGG   Paenibacillus terrae: HPL003_23695Help
Entry
HPL003_23695      CDS       T01668                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase and like 2-oxoacid:ferredoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00020  Citrate cycle (TCA cycle)
pta00620  Pyruvate metabolism
pta00640  Propanoate metabolism
pta00650  Butanoate metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Module
pta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_23695
   00020 Citrate cycle (TCA cycle)
    HPL003_23695
   00620 Pyruvate metabolism
    HPL003_23695
   00640 Propanoate metabolism
    HPL003_23695
   00650 Butanoate metabolism
    HPL003_23695
  Energy metabolism
   00680 Methane metabolism
    HPL003_23695
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPL003_23695
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPL003_23695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4_7 Fer4 Fer4_6 Fer4_10 Fer4_16 Fer4_2 Fer4_17 Fer4_9 Fer4_4 Fer4_21 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AET61457
UniProt: G7VS87
Position
complement(5156381..5157394)
Genome map
AA seq 337 aa AA seqDB search
MSILTRTNRLGFFEIRLESIGGLGANLAGKMLAETGVLGLGLNASNFSSYGSEKKGTPVK
SFVRFCDPGVDIRDHSPIEQPHVVGIFHEALYKTVNVISGLPADGIVVVNSTRPAEEIRA
DLGLVSGTLAVVDAMGIALEERTKLNTSMLGALFRVCDFLDPEAMRSVIRSTFEKKNPQL
VEPNLRTFNRGFEEMELHVYPVTSDAQDRIFERPQPLLGYETQPSGGVIATQGNSMTRDV
SGSRQGFVPEYEADKCTHCAKCDSICPDYCFVWEEQADKRGRMIPFLQGIDYQYCKGCLK
CVDICPSGALSSRREQWGWAEQNRVAHQFPVYEGGRV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgtctattttaacgcgcacaaatcgactcggattttttgaaatccggctggaatccatt
ggtggactcggcgctaatctggctggtaaaatgctggccgaaacgggcgttcttggtctg
gggctgaatgcttccaatttctcgtcctacggttcagaaaagaagggaaccccggtcaaa
agctttgtacgtttctgtgatcccggggtcgatatccgtgatcacagtccgattgagcaa
ccgcatgtagtaggcatttttcatgaagcattgtacaaaacggtcaatgtcatcagcggg
cttccagcggatgggatcgttgtggtcaattccacgcgtccggcagaggaaatacgggct
gatttgggattggtatccggcacgctggcggtagtggatgcgatgggcatcgcactggag
gagcggaccaagctaaatacgtccatgttgggtgcgctgttccgtgtctgtgatttttta
gatccagaggcgatgagatcggttattcgcagtacctttgagaagaaaaatccacagctg
gtggagcctaatttgcgtacgtttaaccggggctttgaggaaatggagctacacgtatat
ccggttacgagcgatgcacaggatcgcatttttgaacggccgcagcctttgctgggctat
gaaacacaaccctcgggaggtgttattgccacgcagggaaacagcatgacgagagatgtc
agcggttcacgtcagggctttgtgcctgaatatgaagctgataaatgtacgcattgtgcc
aagtgtgattcgatttgcccggattactgttttgtatgggaagagcaagcagacaaacgc
ggaagaatgattccatttttgcaaggaattgattaccagtattgcaaaggatgtctgaaa
tgtgtagatatttgcccatcgggggcattaagctcgcgtcgcgaacaatggggatgggcg
gaacagaatcgagttgcccaccaatttccggtatatgaaggaggacgtgtgtaa

DBGET integrated database retrieval system