KEGG   Paenibacillus terrae: HPL003_24230Help
Entry
HPL003_24230      CDS       T01668                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00071  Fatty acid degradation
pta00350  Tyrosine metabolism
pta00620  Pyruvate metabolism
pta00625  Chloroalkane and chloroalkene degradation
pta00626  Naphthalene degradation
pta00650  Butanoate metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_24230
   00620 Pyruvate metabolism
    HPL003_24230
   00650 Butanoate metabolism
    HPL003_24230
  Lipid metabolism
   00071 Fatty acid degradation
    HPL003_24230
  Amino acid metabolism
   00350 Tyrosine metabolism
    HPL003_24230
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HPL003_24230
   00626 Naphthalene degradation
    HPL003_24230
Enzymes [BR:pta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HPL003_24230
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HPL003_24230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AET61564
UniProt: G7VV67
Position
complement(5248401..5251013)
Genome map
AA seq 870 aa AA seqDB search
MAVKNEVIQKEQSAEQYIQTLIDRGNRAQQAFMSMNQEQIDEIVQAMALAGMDKHMHLAK
LAVEETGRGVYEDKITKNMFATEYVYHSIKNEKTVGVIEDNDFDSFQKIAEPVGIIMGIT
PVTNPTSTTMFKALIAIKTRNPIIFGFHPSAQSCSAEAARVLLEAAVKHGAPADCIQWIE
APSMDKTNSLMNHPDVALILATGGSGMVKAAYSCGKPALGVGPGNVPCFIEKTADIKQAV
NDLILSKSFDNGMICASEQAVIIEEPIFEQVKKLMIANGCYFVNKEEAAKLTQGAMNVEK
CAVNPAIVGQSAVKIAEMSGITVPAGTKILVAEIEGVGTKFPLSAEKLSPVLACYKVKNA
EQGIQRAAEVVEFGGMGHSSAIHSNDEDVIARFANRLQTGRIIVNSPSTHGAIGDIYNTN
LPSLTLGCGSYGRNSTSSNVSAVNLINVKRVAKRTVNMQWFKVPSKIYFEKNSTQYLAKM
PDITRVAIITDPMMVKLGYVDRVIHYLHQRQTPVAIEVFSEVEPDPSTVTVERGTEMMRR
FQPDCIIALGGGSPMDAAKGMWMFYEYPDTDFNNLKQKFMDIRKRIYKYPRLGQKAQFVA
IPTTSGTGSEVTSFAVITDKNQGNTKYPLADYELTPDVAIIDPEFVYSLPKTAVADTGMD
VLTHAIEAYVSVMASDYTDGLAIKAIQLVFQYLEQSALSGDKLAREKMHNASTLAGMAFA
NAFLGINHSLAHKWGGQYHTAHGRTNAILLPHVIRYNAKKPTKFASFPKYSHFVADERYA
EIARILGLPARTTEEGVNSLIEAIRKLNKTLGIEESFQQIGFDAKDFESRVDYLADRAFE
DQCTTANPKLPLVTELADVYRNAFYGRFDQ
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggctgttaaaaacgaggttatccaaaaagagcaaagcgctgagcagtatattcaaaca
ctgattgaccgggggaaccgggcacagcaggctttcatgagcatgaatcaggagcagatt
gacgaaatcgtacaagctatggcactcgcagggatggataagcacatgcatctggcgaag
ctggctgttgaagaaacaggacgcggtgtgtacgaggacaaaatcaccaaaaacatgttt
gcaacagaatatgtctatcatagtatcaaaaatgaaaaaaccgtcggtgtcattgaagat
aatgactttgacagttttcaaaaaatagcagaacccgtcggcatcattatggggatcact
ccagtgactaatccgacttcaactacaatgttcaaagcgttgattgctattaaaacacgt
aacccaatcattttcggtttccatccatccgctcaatcgtgtagtgcggaagcagctcgc
gtcttgcttgaagcagccgtcaaacatggtgctccggccgattgtattcaatggattgaa
gctccatcgatggataagacaaattcacttatgaatcaccctgatgtggcattgattctg
gcaactggtggatcaggtatggttaaggcggcatatagctgcggtaaacctgctctgggt
gtaggcccaggtaacgtgccttgctttattgaaaaaacagcagacatcaagcaggccgtg
aatgacctcatcctctccaaatcttttgataacggtatgatctgtgcttccgagcaagcg
gttattatcgaagagccaatcttcgaacaagtgaaaaaattgatgatcgctaacggttgc
tactttgtaaataaagaagaagcagctaagctcactcaaggagctatgaatgtcgagaaa
tgtgcagtgaacccagctattgtcggacagtctgctgtaaaaattgctgaaatgagcggt
atcaccgtaccagcaggaactaaaattttggttgctgagattgaaggagtaggaacaaaa
ttcccattgtctgcggaaaaattgagtcctgtattggcttgctataaagtgaaaaatgct
gaacaaggtattcaacgcgctgctgaagtcgtggaattcgggggcatgggccactcgtcc
gctattcattcgaacgatgaggacgttatcgctcggttcgcaaaccgtttgcaaacaggc
cgtatcattgtaaattcgccttccacacatggtgcgatcggtgacatttacaacaccaac
cttccatcgctgacactcggttgtggttcgtacggacgtaactcgacttcgtcgaacgta
tcggcagtcaacttgattaatgtgaaaagggtggcgaaacgtacggtgaatatgcaatgg
ttcaaagtaccttccaaaatttattttgaaaaaaattcgactcagtatcttgctaaaatg
cctgatatcacacgcgtagccattattacagaccctatgatggtgaaactcggatatgtg
gatcgtgtcatccattatttacaccagcgtcaaacaccagtagctatcgaagtgttctcg
gaagtagagccagacccatcgacagttacggtagaacgtggtactgaaatgatgagacgt
ttccaaccggattgcattattgccttgggtggcggttcgccaatggatgcagctaaaggc
atgtggatgttctatgaatacccagatactgacttcaacaacttgaaacaaaaattcatg
gatatccgcaaacggatctacaagtacccgcgtcttggtcagaaagcacaatttgtggcc
attcctacaacctcgggtacaggttcggaagttacgtcgttcgcagttattacagataaa
aatcagggcaacacgaagtatccgctggctgactatgagctgactcctgatgtggcaatt
attgaccctgagtttgtatactcgctgcctaaaacagctgtagcggatacaggtatggac
gtactgacacatgccatcgaggcctacgtgtccgtaatggctagtgactacacagacggt
ctggcaattaaagccattcaactggtattccaatacctggagcaatcagctctgagtggc
gacaaactggctcgtgaaaaaatgcataatgcttccacactggcagggatggcgtttgcc
aatgcattcctgggtattaaccacagtcttgcgcacaaatggggcggacaataccataca
gcgcatggtcgcacgaatgccattctgttaccacacgtcattcgttataatgcgaaaaaa
ccgacgaaattcgcttcgttccctaaatattcgcactttgttgcggatgagcgttatgca
gaaattgcacgcatactggggctgcctgcccgtaccacggaagaaggggttaacagcctg
atcgaagcaatccgcaagctgaacaaaacactcggtatcgaggaatcgttccagcaaatc
ggcttcgatgcaaaggactttgaatcgcgtgtagattatctggctgaccgcgcttttgag
gatcaatgtacaactgcgaatccaaaattgccgctggttactgaattggctgatgtatac
cgcaacgccttctacggacgttttgaccaataa

DBGET integrated database retrieval system