KEGG   Paenibacillus terrae: HPL003_24475Help
Entry
HPL003_24475      CDS       T01668                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pta  Paenibacillus terrae
Pathway
pta00230  Purine metabolism
pta01100  Metabolic pathways
Module
pta_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HPL003_24475 (gmk)
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HPL003_24475 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 RsgA_GTPase AAA_16 AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AET61611
UniProt: G7VVB4
Position
complement(5300983..5301555)
Genome map
AA seq 190 aa AA seqDB search
MAKGLLFVLSGPSGVGKGTVGSALREKLPELTYSVSATTRTPRMGEQDGVNYFFKSREQF
LGMIERDELLEHAEYVGNYYGTPRDFVDQTLAQGKDIFLEIEVQGALKVKEKFPDGIFIF
LLPPSLDELKDRIRGRGTETQATIDHRMSVAVDEMNLLRHYDYAVVNDEIDFACKRIESI
IIAEHCKVHP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctaagggattattatttgtattatctggaccttcgggtgtcggcaaaggaacagta
ggcagcgcactgcgtgaaaaactgccggaattgacatactcagtttccgcgacaacccgt
acgccccgcatgggggaacaggacggagttaactatttttttaagtcgcgtgaacagttt
ttgggcatgattgaacgggatgagctgctggagcatgcagagtacgtaggtaactattac
ggcactccacgtgattttgtagatcagacgcttgcgcagggaaaagatatttttctggag
attgaggttcagggagcgctcaaagtgaaggagaaatttcctgatggcattttcattttc
ttgcttccaccttcgttggatgaattgaaggaccggattcggggacggggtacagaaact
caggcaactattgatcaccgcatgtcggtagctgtggatgaaatgaatctgttgcgtcac
tatgattatgcggttgtcaatgatgagattgatttcgcttgtaaacgaatagaatccatt
attatcgccgaacattgtaaagtccatccataa

DBGET integrated database retrieval system