KEGG   Paenibacillus terrae: HPL003_24785Help
Entry
HPL003_24785      CDS       T01668                                 

Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pta  Paenibacillus terrae
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pta00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5376886..5378985)
Genome map
AA seq 699 aa AA seqDB search
MSQQNIIKYPPISERVPRMLHGADYNPEQWQHYPEVLKEDIRLMKLAKCNVMSVGIFSWV
SLEPEEGVFTFEWLDRILDSFAENGIYAFLATPSGARPAWMSQKYPEVLRVEANRVRNLH
GFRHNHCSTSPVYREKVRIMNSKLAERYANHPAVIGWHISNEFGGDCHCDYCQEAFRAWV
QDKYGTLDKLNHAWWTTFWSHTVTDWSQIESPAPHGETQVHAMNLDWRRFVTDQTADFIK
HEIVPLKAANPELPVTTNLMEFFEGLNYWKFADLLDVVSWDSYPTWHDRGGDDSRQAAKV
AMMHDIIRSIKGGKPWMLMESTPSLTNWQEISKLKRPGMHLLSSLQAVAHGSDTVQYFQW
RKSRGSSEKLHGAVVDHVGHEHTRVFGDVTNVGNALEKLEEVIGTSVPAEAAVIFDWENR
WAVNDSQGPRNKGVKYEETAEAHYLALWEQGVPVDVIHMDADFSKYKLVVAPMLYMVRSG
VGERIQKFVESGGIFVATYWSGIVDEHDLCFLEGFPGPLRKTLGIWSEEIDGLHDHDRNH
ILPVEDNELDLHGEYEAVELCDLIHTEGAEVLAVYGSDFYAGRPALTVNRLGQGKAYYIA
SRNTGSFNSHFYKSLIDGAGISKALNVQLPHGVNTAIRTDGVHDYIFILNFTHEPQEIRL
DGRIYADMLENQVVEDGKVRLDAYAVKVLKTERSKSEIV
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcagcaaaacataatcaaatacccgccaatcagtgagcgagttccacgtatgctt
catggagcggactataacccggagcaatggcagcattatcccgaggtgctaaaagaggat
attcgtctgatgaaactggctaaatgtaacgtgatgtccgttggcatattttcatgggtt
tcattagaacctgaggaaggcgtattcacgttcgaatggctggatcgtatcctggattcg
tttgctgagaacggaatctatgcgtttttagctactccaagtggagcaagacctgcctgg
atgtcgcaaaaatatcctgaggtgctgcgtgtagaggccaaccgtgtccgtaacttgcat
gggtttcgtcataatcactgttctacgtcacctgtctaccgggaaaaggtacgtatcatg
aattcgaagctggccgagcgttatgctaatcatccggctgtcattggttggcatatttcc
aatgaatttggtggggattgccactgtgattattgtcaggaggcgtttcgcgcatgggtg
caggataaatacggcacgctggataaacttaatcacgcatggtggacgaccttctggagt
catacggttacggattggagccaaatcgagtctccggcacctcacggtgaaacgcaggtt
catgccatgaatttggactggagacggtttgtgaccgatcagaccgcagattttatcaaa
catgagattgtgccgctcaaggctgcgaaccccgaacttccggtcacaaccaatttaatg
gagttttttgaaggattgaattattggaagttcgccgatctgcttgatgttgtatcctgg
gacagctatccaacgtggcatgaccgggggggagatgatagccgtcaggctgcgaaagtg
gctatgatgcatgatattatccgttcaatcaagggtgggaagccttggatgctgatggag
agtacgccaagcttgacaaattggcaggaaattagcaagctgaagcgacccggaatgcac
ctgctatcatctttacaggctgtggcacacgggtcagatacagtccagtatttccagtgg
cggaaaagccgcggttcgagtgaaaaattgcatggtgcagtcgtcgaccatgtggggcat
gaacatactcgggtgttcggggatgtgacaaatgtgggcaacgctttggaaaaactggaa
gaggttatcggcacatctgtaccagcagaggcggcagtcatttttgattgggagaatcgc
tgggcggtcaacgactcacaagggccacgtaataaaggtgtaaaatacgaagagacagcc
gaagcacattatttggctttgtgggagcagggtgtgcctgtagatgtcattcatatggat
gcagatttctccaaatacaaacttgtggtagctccaatgctatatatggtgcgcagcggt
gtaggtgagcgaatacaaaagtttgttgaaagcggtggcatttttgtagcaacctattgg
tccggtattgtggatgaacatgatttgtgcttccttgaaggctttccggggccgcttcgt
aagacgcttgggatctggtcggaagagattgatgggctgcatgatcacgaccgtaatcat
attttgccagttgaagataatgagttggatctgcatggcgagtatgaggctgtagaactg
tgcgatctcattcatacggaaggtgcagaggtactggctgtatacggttcagacttttat
gcaggacgcccagccttgacggtgaaccgcttgggacagggaaaagcttattacatcgct
tcacgcaacacgggatcgttcaacagccatttttacaaaagtttgattgatggcgcagga
attagtaaagcactcaatgttcagttgccgcatggagtgaatacggcgattcgtaccgat
ggagttcatgattatattttcatactgaatttcacccatgagccgcaagagattaggctg
gatggacggatttatgcagatatgctcgaaaatcaggtggtggaagacggcaaggttcga
ttggatgcctatgctgttaaggtactaaagacagagcggagtaaatcggaaatagtatag

DBGET integrated database retrieval system