KEGG   Paenibacillus terrae: HPL003_26410Help
Entry
HPL003_26410      CDS       T01668                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00260  Glycine, serine and threonine metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
pta01230  Biosynthesis of amino acids
Module
pta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pta_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_26410
  Energy metabolism
   00680 Methane metabolism
    HPL003_26410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_26410
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HPL003_26410
Membrane trafficking [BR:pta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HPL003_26410
Exosome [BR:pta04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HPL003_26410
  Exosomal proteins of melanoma cells
   HPL003_26410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AET61996
UniProt: G7VR97
Position
complement(5731592..5732167)
Genome map
AA seq 191 aa AA seqDB search
MKTFIYMVRHGDSPKTAGNERTRGLTDKGMSDANRTTELLNGEGIEVFVSSPYQRAILTI
QELARRSGKEIILFENLKERIFSTDDHRMPDEDLFPLLEKSFSDPDFALVGAESNNGCQS
RAVAVLKELLTAFRGRKIAIGTHGAVMTLMMGYFDRQYDYHFLMQTSKPDVYKMEFNGEE
LVKVERLWNIR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttcatctacatggtgaggcatggcgattcgccaaagacggcaggaaatgaa
agaacaagagggttaactgataaaggaatgtcggatgccaatcgaacaacagaattattg
aatggggagggaatcgaggttttcgtttccagtccgtatcagagggcaatccttaccatt
caggagttggcccggcgttcaggaaaagaaatcattttatttgaaaatctgaaagaaaga
attttttccacagatgaccaccggatgcctgatgaggatttattcccattgttggagaag
tcgttttctgatcccgattttgctttggtgggagcggaatcgaataacggttgccagagc
cgtgcggtagcggttttgaaagaattattaacggccttccggggacggaaaatagcaatt
ggaacccatggagctgtcatgacattaatgatggggtattttgaccgccaatatgattac
cattttttaatgcaaacctccaaaccggatgtatacaaaatggagttcaacggcgaagag
ctagtgaaggttgagagattgtggaacatccggtaa

DBGET integrated database retrieval system