KEGG   Paenibacillus terrae: HPL003_26475Help
Entry
HPL003_26475      CDS       T01668                                 

Definition
(GenBank) acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pta  Paenibacillus terrae
Pathway
pta00300  Lysine biosynthesis
pta01100  Metabolic pathways
pta01120  Microbial metabolism in diverse environments
pta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HPL003_26475
Enzymes [BR:pta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HPL003_26475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AET62009
UniProt: G7VRB0
Position
complement(5747584..5748855)
Genome map
AA seq 423 aa AA seqDB search
MTDWKTLVLDEIEKRQDELLELCSRLIQFPSENPPGDSREISQFIMDYLKEAGIETTIHE
SGPNMWNLISDYGAETADGKKLIFCGHTDVVPAGDRTRWDFDPFCGEIRDGYLLGRGASD
MKAGLGGLIFTVALFSKLGVPLEGALSLLVVPDEETGGHLGVPWVLERKLIEGTAAVIAE
PSGPQNPTIGQKGSCWFEFTVEGTPGHGSLQPIAGESAILKAARGIEALQQLWDIKPDIP
EEVKEIIEISKRYVSERENPSYGQAFDHVTVNIGTIQGGTKVNVVADRCTVQVDSRVPFG
VDHRDVLARAKELLASVGIDAEPKQFGFFGNANWTPPTEPIVHDLVDSIAEVSGKEAYGV
LQWATSDARAFRKYHIPVLQYGPADLGTIHNFNERAPVWQILQSAKVYALTALKYLKTTK
TEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacagattggaaaacgttagttcttgatgaaatagaaaaacggcaggacgaattgctg
gagctttgttcgcggttaattcagtttccctcggaaaatcctccaggtgattcacgtgaa
atcagtcagtttattatggactaccttaaagaagcggggattgaaacaactatacatgaa
tccgggccgaatatgtggaacctcatttctgattatggcgctgaaacggcggacggaaaa
aaactgattttctgtgggcatacagacgttgtgccagcaggggatcgtacccgttgggat
tttgatccgttctgtggtgaaatacgtgatggctatctgcttgggcgcggggcttcggac
atgaaagccggactgggcggattaatatttactgttgcgctgttttccaaactaggcgta
ccgctcgaaggtgcgttgtcgttgcttgtagttccagacgaagaaactgggggacatctt
ggagtaccttgggtgctggaaagaaaactaattgaaggaacggctgctgtgatcgcagag
ccttcaggcccgcaaaacccgacaatcggtcaaaaaggaagctgctggtttgagtttacc
gttgaaggcacgccgggtcacggcagtctgcaaccgatcgcaggtgaaagtgctatttta
aaagcagcaagaggaattgaagctctgcaacaactgtgggatatcaaacctgatattcca
gaagaagtaaaagagatcattgaaatttccaagcgttatgtaagcgaacgggaaaaccca
agctatgggcaagcatttgaccatgtaactgtgaacattggtacgattcaggggggcacc
aaagtcaatgtggttgccgaccgttgtacggtacaagtggattcccgtgttccttttggt
gtagaccatcgggatgtactggctagagcgaaagaattgcttgcaagtgtaggcattgat
gctgaacccaaacagttcgggtttttcggtaacgccaactggaccccgccgaccgaaccg
attgtgcatgatcttgtggattccatcgctgaggttagcggtaaagaagcctatggggtg
ttgcagtgggcaaccagtgatgcccgtgcattccgcaaatatcatattccggtattgcaa
tatggacctgcggaccttggaaccatccacaacttcaacgaaagagctccggtatggcaa
atccttcaatccgcgaaagtatacgccttgacggcgcttaaatatctgaaaactacaaaa
acagaagcttaa

DBGET integrated database retrieval system