KEGG   Paenibacillus terrae: HPL003_26475Help
Entry
HPL003_26475      CDS       T01668                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pta  Paenibacillus terrae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pta01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pta00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5747584..5748855)
Genome map
AA seq 423 aa AA seqDB search
MTDWKTLVLDEIEKRQDELLELCSRLIQFPSENPPGDSREISQFIMDYLKEAGIETTIHE
SGPNMWNLISDYGAETADGKKLIFCGHTDVVPAGDRTRWDFDPFCGEIRDGYLLGRGASD
MKAGLGGLIFTVALFSKLGVPLEGALSLLVVPDEETGGHLGVPWVLERKLIEGTAAVIAE
PSGPQNPTIGQKGSCWFEFTVEGTPGHGSLQPIAGESAILKAARGIEALQQLWDIKPDIP
EEVKEIIEISKRYVSERENPSYGQAFDHVTVNIGTIQGGTKVNVVADRCTVQVDSRVPFG
VDHRDVLARAKELLASVGIDAEPKQFGFFGNANWTPPTEPIVHDLVDSIAEVSGKEAYGV
LQWATSDARAFRKYHIPVLQYGPADLGTIHNFNERAPVWQILQSAKVYALTALKYLKTTK
TEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacagattggaaaacgttagttcttgatgaaatagaaaaacggcaggacgaattgctg
gagctttgttcgcggttaattcagtttccctcggaaaatcctccaggtgattcacgtgaa
atcagtcagtttattatggactaccttaaagaagcggggattgaaacaactatacatgaa
tccgggccgaatatgtggaacctcatttctgattatggcgctgaaacggcggacggaaaa
aaactgattttctgtgggcatacagacgttgtgccagcaggggatcgtacccgttgggat
tttgatccgttctgtggtgaaatacgtgatggctatctgcttgggcgcggggcttcggac
atgaaagccggactgggcggattaatatttactgttgcgctgttttccaaactaggcgta
ccgctcgaaggtgcgttgtcgttgcttgtagttccagacgaagaaactgggggacatctt
ggagtaccttgggtgctggaaagaaaactaattgaaggaacggctgctgtgatcgcagag
ccttcaggcccgcaaaacccgacaatcggtcaaaaaggaagctgctggtttgagtttacc
gttgaaggcacgccgggtcacggcagtctgcaaccgatcgcaggtgaaagtgctatttta
aaagcagcaagaggaattgaagctctgcaacaactgtgggatatcaaacctgatattcca
gaagaagtaaaagagatcattgaaatttccaagcgttatgtaagcgaacgggaaaaccca
agctatgggcaagcatttgaccatgtaactgtgaacattggtacgattcaggggggcacc
aaagtcaatgtggttgccgaccgttgtacggtacaagtggattcccgtgttccttttggt
gtagaccatcgggatgtactggctagagcgaaagaattgcttgcaagtgtaggcattgat
gctgaacccaaacagttcgggtttttcggtaacgccaactggaccccgccgaccgaaccg
attgtgcatgatcttgtggattccatcgctgaggttagcggtaaagaagcctatggggtg
ttgcagtgggcaaccagtgatgcccgtgcattccgcaaatatcatattccggtattgcaa
tatggacctgcggaccttggaaccatccacaacttcaacgaaagagctccggtatggcaa
atccttcaatccgcgaaagtatacgccttgacggcgcttaaatatctgaaaactacaaaa
acagaagcttaa

DBGET integrated database retrieval system