KEGG   Paenibacillus terrae: HPL003_26765Help
Entry
HPL003_26765      CDS       T01668                                 

Definition
threonine synthase (TS)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pta  Paenibacillus terrae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPL003_26765
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPL003_26765
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPL003_26765
Enzymes [BR:pta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPL003_26765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5808113..5809504)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGRVEAKGFIDTVLMGLADDGGLMVPEQIPVVSAATLEQWATLSYRELLLEVFA
LYINDEIPREDLEQLVERSYASFRHPEVTPVKKINDSLYILELFHGPTFAFKDVALQFMG
EFYSYVSKKQNEIIHILGATSGDTGAAAIQGVRGKEGIKICILHPHQKVSKVQELQMTTV
DDENVLNLSVKGNFDDCQKVIKDLFADLDFKGKHHLRAINSINFVRILAQTVYYFYAYFR
AQESAGTKKINVSVPSGNFGNIFSGFLAKKMGLPIHKLIIATNENNILERFVKTGEYKPG
GFKSTYSPSMDIQVASNFERYLYYFLGEDAAKVTEYMNALQTEGRIVISAEDLQRVQQDF
EALGASNEQCLELISKYKAEYDYLLDPHTACGIAAYEAHNGEDEVCVTFATAHPAKFDEA
IRLVDIKQEFPAQIEQLFSKSQHQQVVEHDEAEIVRLLEAFYV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataagcactagaggtcgagtagaagccaagggatttattgataccgtgctc
atggggttagctgacgatggtggcctgatggtgccggagcaaattccggtggtgtcggca
gctacgctggagcaatgggcaacattgagctacagagagctgctgctggaggtttttgcg
ctgtatatcaatgatgaaattcctcgtgaagatttggagcaactggtggagcgcagctat
gcgagcttccgtcatcccgaagtcacgccagtgaagaagatcaacgattctctctatatt
ttggagttgttccacgggcctacgttcgcattcaaggatgtggcgctgcaatttatgggt
gaattttattcctatgtgtccaagaagcagaatgagatcattcacattttgggcgcaacc
tcaggcgataccggggcggcagccattcagggcgtacgtggcaaggaaggcattaaaatc
tgtattttgcatccgcatcaaaaagtaagcaaggtacaagagctgcaaatgacgaccgtt
gacgatgaaaatgtactgaatctttcagtaaaaggaaactttgacgattgccaaaaagtc
atcaaggacctgtttgctgatctggatttcaaaggcaaacatcatctgcgtgcgattaat
tcgattaactttgtacgtattttggcgcaaactgtatattacttctatgcctatttccgg
gcgcaggagtctgcgggtacgaagaagatcaatgtcagcgtgccatccggcaactttggc
aatattttttccggctttcttgccaagaaaatgggcctgccgattcataagctgattatt
gccacgaacgaaaacaatattttggagcgcttcgtgaagacaggcgaatacaaaccaggc
ggcttcaaaagcacgtatagtccttccatggacattcaggtggcaagcaatttcgaaaga
tatctgtactacttccttggagaagatgcagcgaaggtaactgaatacatgaatgctctc
caaaccgaaggacggattgtgatcagtgcagaggatttgcaacgcgtacagcaagatttt
gaagcccttggtgcttcgaacgagcagtgtctggagctgatcagcaaatacaaagccgaa
tatgactatttgctggacccgcataccgcttgtggtattgcagcgtatgaggcccacaac
ggcgaggatgaagtatgtgtgacctttgcaacggcgcatccggccaaattcgacgaagcg
atccgtctggtggacattaagcaggagttcccggcgcagatcgagcagttgttttccaaa
tcacagcaccagcaagtggtagagcatgacgaggccgaaattgtgcgtctgcttgaagcc
ttttatgtgtag

DBGET integrated database retrieval system