KEGG   Paenibacillus terrae: HPL003_26765Help
Entry
HPL003_26765      CDS       T01668                                 

Definition
threonine synthase (TS)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pta  Paenibacillus terrae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pta01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pta00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pta00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5808113..5809504)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGRVEAKGFIDTVLMGLADDGGLMVPEQIPVVSAATLEQWATLSYRELLLEVFA
LYINDEIPREDLEQLVERSYASFRHPEVTPVKKINDSLYILELFHGPTFAFKDVALQFMG
EFYSYVSKKQNEIIHILGATSGDTGAAAIQGVRGKEGIKICILHPHQKVSKVQELQMTTV
DDENVLNLSVKGNFDDCQKVIKDLFADLDFKGKHHLRAINSINFVRILAQTVYYFYAYFR
AQESAGTKKINVSVPSGNFGNIFSGFLAKKMGLPIHKLIIATNENNILERFVKTGEYKPG
GFKSTYSPSMDIQVASNFERYLYYFLGEDAAKVTEYMNALQTEGRIVISAEDLQRVQQDF
EALGASNEQCLELISKYKAEYDYLLDPHTACGIAAYEAHNGEDEVCVTFATAHPAKFDEA
IRLVDIKQEFPAQIEQLFSKSQHQQVVEHDEAEIVRLLEAFYV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataagcactagaggtcgagtagaagccaagggatttattgataccgtgctc
atggggttagctgacgatggtggcctgatggtgccggagcaaattccggtggtgtcggca
gctacgctggagcaatgggcaacattgagctacagagagctgctgctggaggtttttgcg
ctgtatatcaatgatgaaattcctcgtgaagatttggagcaactggtggagcgcagctat
gcgagcttccgtcatcccgaagtcacgccagtgaagaagatcaacgattctctctatatt
ttggagttgttccacgggcctacgttcgcattcaaggatgtggcgctgcaatttatgggt
gaattttattcctatgtgtccaagaagcagaatgagatcattcacattttgggcgcaacc
tcaggcgataccggggcggcagccattcagggcgtacgtggcaaggaaggcattaaaatc
tgtattttgcatccgcatcaaaaagtaagcaaggtacaagagctgcaaatgacgaccgtt
gacgatgaaaatgtactgaatctttcagtaaaaggaaactttgacgattgccaaaaagtc
atcaaggacctgtttgctgatctggatttcaaaggcaaacatcatctgcgtgcgattaat
tcgattaactttgtacgtattttggcgcaaactgtatattacttctatgcctatttccgg
gcgcaggagtctgcgggtacgaagaagatcaatgtcagcgtgccatccggcaactttggc
aatattttttccggctttcttgccaagaaaatgggcctgccgattcataagctgattatt
gccacgaacgaaaacaatattttggagcgcttcgtgaagacaggcgaatacaaaccaggc
ggcttcaaaagcacgtatagtccttccatggacattcaggtggcaagcaatttcgaaaga
tatctgtactacttccttggagaagatgcagcgaaggtaactgaatacatgaatgctctc
caaaccgaaggacggattgtgatcagtgcagaggatttgcaacgcgtacagcaagatttt
gaagcccttggtgcttcgaacgagcagtgtctggagctgatcagcaaatacaaagccgaa
tatgactatttgctggacccgcataccgcttgtggtattgcagcgtatgaggcccacaac
ggcgaggatgaagtatgtgtgacctttgcaacggcgcatccggccaaattcgacgaagcg
atccgtctggtggacattaagcaggagttcccggcgcagatcgagcagttgttttccaaa
tcacagcaccagcaagtggtagagcatgacgaggccgaaattgtgcgtctgcttgaagcc
ttttatgtgtag

DBGET integrated database retrieval system