KEGG   Paenibacillus terrae: HPL003_27995Help
Entry
HPL003_27995      CDS       T01668                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pta  Paenibacillus terrae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pta03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6080652..6081266)
Genome map
AA seq 204 aa AA seqDB search
MIDFLRGSVAHLENEYVVLDVQGVGYRVFCPNPYAFAKKEGPVVIYIHHHVREDAILLFG
FATREEQQLFRKLIDVSGIGPRVALGILGGGTPTHVVTAIYQENIAFLTKLPGIGKKTAQ
RMILDLKDKLDGIGSIGIATGLFAEPVVEEGEGSYWSEAREALKALGYTDAELDKVWSRM
KKDAKPDESADILMKRALQLLFAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttcttgcgtggttccgtggctcacttggaaaatgaatatgtcgttttggat
gtgcagggtgtcgggtaccgggtgttttgtccaaatccttatgcctttgccaaaaaggaa
gggcctgttgtcatttatattcatcatcatgtaagggaagatgctattttattgttcggg
tttgcgactcgtgaggaacagcagttgttccgtaagctgattgatgtatccggaattggg
ccgcgtgtggcactaggcatcttgggaggcggtacacctactcatgtggtaacggcaatc
tatcaggagaacatcgcatttctcaccaaactgccgggtatcggtaaaaagacagcacag
cgcatgattttggatttgaaggataagctggacggcatcggttcaatcggcattgcgacg
ggattgtttgcggagcctgtcgtggaagaaggcgagggttcctattggagcgaggcacga
gaagcgcttaaggcgctgggctacacagatgcagagctggataaggtatggagcagaatg
aagaaagatgcgaaacctgatgaatccgccgatattttgatgaagcgggctttgcaactg
ttgtttgccggatag

DBGET integrated database retrieval system