KEGG   Pyrenophora teres: PTT_00362Help
Entry
PTT_00362         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pte  Pyrenophora teres
Pathway
pte00511  Other glycan degradation
pte00513  Various types of N-glycan biosynthesis
pte00520  Amino sugar and nucleotide sugar metabolism
pte00531  Glycosaminoglycan degradation
pte00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTT_00362
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    PTT_00362
   00531 Glycosaminoglycan degradation
    PTT_00362
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    PTT_00362
   00604 Glycosphingolipid biosynthesis - ganglio series
    PTT_00362
   00511 Other glycan degradation
    PTT_00362
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PTT_00362
Chaperones and folding catalysts [BR:pte03110]
 Intramolecular chaperones
  Others
   PTT_00362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b GHL6
Motif
Other DBs
NCBI-ProteinID: EFQ96605
UniProt: E3RCD9
Position
Unknown
AA seq 614 aa AA seqDB search
MRDFILASALTASALFAGHAEAVAANPLPAPTKIVWGNSGCFSFAPSGSFDLPQSKLLSD
AADRTMKSITTLKWVPQAVEAPVREFEPFPGATTKASRRKNRRQYNAAPAGNCTGSVKNV
RITVANLNADLQHGVGESYTLNLKDGSDTLFITSQTVYGALHALTTLQQIVISDGTGKLI
IEQPVSIVDAPLYPVRGIMIDTGRNFISKAKIEEQLNAMALSKLNVLHWHLVDSQSWPVE
VKQYPKMTEDAYSANEMFTQDTLKEIVSYAAARGIRVIPEIDMPGHASSGWTQIDESIVT
CEDSWWSNDEWPKHTAVQPNPGQLDILNNKTYEVTGQVYKEMTSIFPDNWFHIGGDELFA
NCNNFSAAALAFFNSGKSMGDLYQVWVDRAIPNFRGIANKTFVMWEDVKISADVAATGNV
PKDIILQAWNNGLDHISNLTAQGYRVIVSSSDFMYLDCGYGGWVGNDPRYNVMVNPNAND
TTIFNFNWGGGGGSWCAPYKTWQRIYDYDFTFNMTDAQKALIQGAIAPLWSEQVDDAVVS
QKMWPRAAALAELVWSGNRDANGKKRTTELTQRILNFREYLVASGVSASPLMPKYCLQHP
HECDLYLNQTALWT
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacttcatattggcctctgccctcacggcctctgcattgtttgccggacatgct
gaagctgttgctgccaaccctcttcctgcaccaacaaagattgtctggggcaactctggc
tgcttctcctttgccccttcaggctcattcgaccttccacagtcaaagctcctcagcgat
gctgcggaccgtactatgaagagcatcaccacgctcaagtgggttcctcaagccgttgaa
gccccggtcagggagtttgagccgttcccaggcgccacaacaaaagcatccaggcgcaag
aacaggaggcaatataacgcggcaccggctggaaactgcacgggctccgtcaaaaacgtc
cggatcaccgtggctaacctcaatgccgaccttcaacacggcgtcggtgaatcctacacg
ctcaatctcaaagatggctcggataccctcttcatcacgtcccagaccgtctacggtgcc
ctccatgctctcaccacgctccagcaaatcgtcatcagcgacggcactggcaagctcatc
atcgagcagcccgtcagcattgttgacgcgcccctctatcccgtccgtggcatcatgatt
gacactggccgcaacttcatctcaaaggccaagattgaagagcaactcaacgccatggcc
ctttccaagctcaacgtcctccactggcatctcgtcgactcccagtcctggcccgttgaa
gtcaagcagtaccctaaaatgacagaagatgcctactctgccaacgagatgttcacccaa
gacacgctcaaggagattgtcagttacgctgctgcacgtggtatccgcgtcatccccgag
attgacatgccgggccacgctagctccggctggacgcaaatcgacgagagcattgtaacc
tgcgaggacagctggtggtccaacgacgaatggcccaagcacactgctgttcagcccaac
ccaggtcaactcgacatcttgaacaacaagacgtacgaagtcacgggccaagtctacaag
gaaatgacatccatcttccctgacaactggttccacattggcggcgacgagctcttcgca
aactgcaacaacttctccgccgctgccctcgccttcttcaacagcggaaagtcaatgggc
gacctctaccaagtctgggtcgaccgcgcaatcccaaacttccgcggcatagcaaacaag
acttttgtcatgtgggaagacgtcaagatctccgccgacgtggccgccacgggcaacgta
ccaaaggacattatcctgcaagcctggaacaacggtcttgaccacattagcaatctcacc
gctcagggctaccgcgtcatcgtctctagctcagacttcatgtacctcgactgcggctac
ggcggctgggttggcaacgacccccgctacaacgtcatggttaacccaaacgcaaacgac
actaccatcttcaacttcaactggggtggcggaggtggctcttggtgcgctccctacaag
acctggcaacgcatctacgactacgacttcaccttcaacatgacggatgcccagaaggcg
ctcatccaaggcgccattgcgcccctctggagcgagcaagtcgacgacgcagtcgttagc
cagaagatgtggccccgtgctgctgccctcgctgaactcgtgtggtctggcaaccgcgac
gcaaacggcaagaagaggactacggagctcacacagaggatcctcaacttcagggagtac
ctcgtcgccagcggtgtgagtgccagcccgctcatgccaaagtactgcctccagcacccg
cacgagtgcgatttgtacctcaaccagacggcgctgtggacctag

DBGET integrated database retrieval system