KEGG   Pyrenophora teres: PTT_00384Help
Entry
PTT_00384         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
pte  Pyrenophora teres
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PTT_00384
Exosome [BR:pte04147]
 Exosomal proteins
  Proteins found in most exosomes
   PTT_00384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1685 aa AA seqDB search
MAQRQVPLHVTQPTLLTNLNILPASISWQNCTLESDKYVCVRQVNNEANAPAETVIIDLK
NTNNVIRRPIRADSAIMHLTEPIIALKAQGRTLQLFNLETKERLQTYSHQEDIQFWRWIS
QTTLALVSTKAVYHWDVLDSKNAVAPRKIFDRQEQLENNQIINYVTNDDESWSCLVGITS
NPAGGIRGNMQLFSKARNVSQPLEGHAATFGTLRLDGASTDTKIFAFAVKSSTGEAKINI
VEVDHNTANPAFPKRLIPIHWPAEGTGDFPLGIHIAHKYGILIVITKFGFIHLHDLETGT
ALFLNRISEETVFTTARDDEGTGVVVINKRGQVLHTTIREDTLIPYIMENPACAEIAYKL
ASKGGLPGADQLYSQRFETLMTQGNFSEAAKVAANSPRGFLRTMNTINRLRQVPNQPGQI
TVLLQYFGQLLDKGGLNKEETLELARPVFAQGRKHLIEKWQKEGKLHCSEELGDLAKPHD
LNLALAIYKEANVSQKVVAALAELGHYDLILQYCNGVGYTPDYNVLLQHVVRISPDKGTE
FASQLAKNEGGPLISIDRVVDIFQSQGMIQQATAFLLDVLSNDLPEEGPMQTKLLEMNLL
NAPQVADAILGNEMFHHYDKMRIAQLCENAGLLTRALEHNDDPAAIKRIIVQTDKLPEEW
LINYFGQLTVELSLESLDAMLTTNIRQNLQAVIRIAQKYSDLLGATRIIDLLEKHRTAEG
LYFFLGSIVNVSEDPDVHFKYIEAATTMGQLNEVERICRESNYLNGEKVKNFLKEANLTE
QLPLIIICDRFNFVHDLVLHLYKKQQFKSIEVYVQRVNPARTPAVIGGLLDVDCDESIIK
GLLDSVTPSSIPIDELVAEVESRNRLKMLLPFLEQTLASGNQQQAVFNALAKIYIDSNNN
PEKFLKENDQYDTLVVGKYCEKRDPNLAALCYSKGMNDLELVNITNENAMFKIQARYLLE
RADSEIWDYVLSPNNIHRRSLVDQVTSSAVPSSTDPDKVSVAVKAFITGDMPAELIDLLE
KIILEPSTFSDNPSLQNLLMLTACKSDRGRVMGYIQQLDQYTPEDIAQQCIEVGMYDEAF
EIFKKHENHVEAVNVLIDHIVSIDRAQEFADRVDRPEVWSRVAKAQLDGLRVTDSIESYI
RAGDASNFLEVIEIATHAGKDEDLIKFLRMARKTLREVPIDTALAFCFARTNQLSELEDF
LRATNVADVEASGDKAYEEGYHEAAKIFYTSISNWAKLATTLVHLDDYQAAVECARKASS
VKVWRQVNEACVAKKEFRLAQICGLNLIVHAEELADLVKQYERNGYFDELISVLEAGLGL
ERAHMGMFTELGIALAKYHPERVMEHLRLFWSRINIPKMIRSCEEAHLWPELIFLYVHYD
EWDNAALGMMERAADAWEHQAFKDTITKATNVEIYYRALGFYLEEQPTLLTDLLQALTPR
IDVNRVVRMFVKSDNIPLIKPFLLNVQSQNKREVNNALNDLLIEEEDYKTLRDSVNNYDN
YDPVELAQRLEKHDLVFFRQIAADIYRKNKRWEKSIALSKQDKLFKDAIETSAISGKPDI
VEDLLRYFVDIGSRECYVGMLYACYDLLRPDVILEMSWRNGLHDFTMPYMINLISQQTAA
IEGLKKDNEERKLREASQQKKEEDTPILGSRLMLTQGPIASAPSPGPYGQANGIAPQPTG
SFRAF
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgacaagttccattgcacgtcacgcagccgacgctgctcacgaacctcaat
attctcccagcatcgatatcatggcaaaactgtacgctcgagtcggacaagtacgtttgt
gtgcgccaggtcaacaacgaagccaacgcgcccgccgagaccgtgatcatcgacctcaag
aataccaacaatgtaattcggagaccgatccgtgctgacagtgccattatgcacttgacc
gagcccatcatcgctctcaaggcacaaggccgaacgctgcaattgttcaacctcgagacc
aaggagcgcctacagacatatagccaccaagaggacatccaattctggaggtggatcagc
cagacgacacttgcactcgttagcaccaaggccgtataccattgggatgtactcgactcc
aagaacgctgttgcgccgcgcaagatctttgaccgccaagaacagctcgagaacaaccag
atcatcaactacgttaccaacgacgacgaaagctggtcttgcctggttggaattacgtcg
aaccctgccggtggtattcggggcaacatgcagctcttttccaaggcgaggaacgtcagc
cagcccctcgagggtcatgcagccacattcggtacccttcgtctagacggcgcatcgacc
gataccaaaatctttgcgtttgctgtcaagtcatctacgggtgaggccaagatcaacatt
gtcgaagtcgaccacaacaccgcgaacccagctttcccgaagcgccttatcccgatccat
tggcccgctgagggtactggcgactttccgctcggcatccacattgctcacaagtacggc
attttaattgtaatcacaaagttcggtttcattcacctccacgatctcgagactggtacc
gccttgttcttgaacagaatatccgaggagacagtcttcacaacagcgcgcgatgacgaa
ggcactggtgtcgtcgtcatcaataagcgtggacaagtactccacacaaccatccgcgaa
gacactctgatcccgtacattatggagaatccggcatgcgcagagatcgcgtacaagctc
gcttcaaagggtggactgcccggcgctgaccaactttactcgcagcgattcgagacgctc
atgacacagggaaacttttcggaagcagcaaaggttgccgccaactctcctcgaggcttt
ttgcgcaccatgaacacgatcaaccgactacgacaagttcctaaccagcccggccaaata
actgtacttttgcaatatttcggtcagctgctggacaagggtggattgaacaaggaagag
acattggagctggctcgacccgtctttgcgcagggccgtaagcacctcattgagaagtgg
cagaaggagggcaagcttcactgctctgaggagcttggtgatttggctaagccccacgac
ctgaaccttgctctagccatttacaaggaggcaaacgtatctcagaaggttgttgcagca
ctcgcagaacttggccactatgacctcatcctccagtactgcaacggcgtcggctacacc
cccgattacaatgtcctgctccagcatgtcgtgaggatttcacccgataagggtaccgag
tttgcttctcaactggcgaagaacgaaggcggaccgcttatcagcatcgaccgcgttgtc
gacatcttccaatctcaaggcatgatccaacaggcgacggcttttctcctggacgttctc
tccaacgacctacccgaggagggccctatgcagaccaagttgctcgaaatgaacttgctg
aacgctccccaagtcgcggatgctatcctaggcaacgaaatgttccaccactacgataag
atgcgcatcgctcaactttgcgagaacgctggtctgctcacacgcgccctggaacacaac
gacgacccggctgccatcaagcgcatcattgtccaaaccgacaagctcccagaagagtgg
ctgatcaattactttggtcagcttactgtagagctttcgctcgaatcgttggatgccatg
cttacgaccaacatccgacagaatctgcaggctgtaatccgcattgcgcaaaagtattca
gacttgctaggcgctacccgaatcatcgatctactggagaagcaccgaactgctgaggga
ctgtacttcttcctgggttccatcgtcaatgtaagcgaggatcccgacgtacacttcaag
tacatcgaggctgcgactaccatgggccaactcaacgaggttgagcgcatctgtcgtgag
agcaactatctcaatggcgaaaaggtcaagaacttcttgaaagaggccaacctaacagaa
cagctacccctcatcatcatctgcgatcggttcaactttgtgcatgatctagtgctccac
ctttacaagaagcagcagttcaagtctattgaagtctacgtccaacgtgtcaaccctgcc
aggactcctgctgttatcggcggcctcctcgacgttgactgtgatgaaagcatcatcaag
ggcctcctggattctgtaacgccatcctccatccccatcgatgagctggtcgcagaggtc
gaatcgcgaaaccgcctcaaaatgcttctgccgttccttgagcagacgttggcgagcggc
aatcagcaacaagccgtattcaacgccttggccaaaatttacatcgatagcaacaacaac
ccggagaagttcctgaaggagaatgaccaatacgacactctggtcgtaggaaaatactgt
gagaagcgagaccccaatctcgcggctttatgctactccaaaggaatgaacgatcttgag
ctggtcaacatcacaaacgagaatgcgatgttcaagattcaggctcgctatctgctggag
cgtgctgattctgagatttgggattacgtgttgagtccaaacaacatccaccggcgatct
ttagtcgatcaggttacttcgtcagcagttccttcgtccactgacccggacaaggtttct
gtggctgtcaaggcattcattactggtgacatgcctgcagaactgatcgacttgctggag
aagattatactggagccgtccactttcagcgacaacccatcacttcaaaacttgctaatg
cttactgcatgcaagtctgatcgtggcagggtcatgggttacatccagcagcttgaccaa
tacacccccgaggatattgcccagcaatgtattgaagttggaatgtacgacgaggctttt
gagatcttcaagaagcacgagaatcatgtggaggctgtcaacgtcctgatcgatcatatt
gtttccattgacagggcacaagaatttgcagacagggtcgacagaccagaagtatggagc
agagttgcaaaggcacagttggacggcctgcgtgtcaccgattctattgagtcttatatt
cgcgctggagatgcctctaacttcctggaagttatcgaaattgcgacccacgctggcaaa
gacgaggacctcatcaagttcttaaggatggcgcgaaagacactccgggaggtccccatc
gatacagcattggcgttctgcttcgctcgtacgaaccagttgtccgagctcgaggacttt
ttgcgtgctactaatgttgccgatgttgaggcttcgggtgacaaggcttacgaagagggc
taccacgaggcggccaagattttctacaccagcatttccaactgggctaagcttgctaca
acccttgtccaccttgatgactaccaggctgctgttgaatgtgcgaggaaggcctcgagc
gtcaaggtctggcgtcaagtcaacgaagcctgtgttgcgaagaaggagttccgccttgcc
cagatttgcggtctcaatctcattgttcatgcggaagaacttgccgatctcgtcaagcag
tatgagcgcaatggctacttcgatgagctcatcagtgtgcttgaggcaggtcttgggttg
gaacgagcgcatatggggatgtttactgaactgggcatcgcgctggccaagtaccacccg
gaacgtgttatggagcaccttcgattgttttggagcagaatcaacatccccaagatgatt
cgctcctgtgaggaagcccatctttggccagagctgatctttctctatgtacactacgac
gaatgggacaacgccgctttggggatgatggaacgtgctgcagatgcttgggaacatcag
gctttcaaggacaccatcacaaaggccaccaacgttgagatctactaccgagccttggga
ttctacctggaggagcagccgactctcttgactgatctcctgcaagcgctcactccccgg
atcgacgtcaaccgcgtggttcgcatgttcgtcaaatctgacaacatccctctcatcaag
cccttccttctgaacgtgcaatcccagaacaagcgcgaggtgaacaacgctctcaacgac
cttttgattgaagaggaggactacaagacgctccgcgactccgtcaacaactatgacaac
tacgacccagtcgagcttgctcagcgcctggagaagcacgaccttgtattcttccgtcag
attgctgccgacatctatcgtaagaataagcgctgggagaagtccatcgcgctttcaaaa
caggacaagcttttcaaggatgccatcgagacgtcagccatatcaggcaagcccgacatt
gttgaggatctgctccgctacttcgtcgacattggcagccgggaatgctacgtcggtatg
ctctatgcctgctacgatctccttcgaccagatgtcattctcgagatgtcatggcgcaat
ggtcttcacgatttcactatgccatacatgatcaacctcatctcccagcagacggccgcg
attgaagggctcaaaaaggacaatgaggagcgcaaacttcgcgaagcttcgcagcagaag
aaggaggaagacactccgatcttgggctcgcgcctcatgctcacgcagggtccgatcgct
tcggctccttccccaggtccctacggacaggctaacggcattgccccacagcccactgga
agcttcagggcattctaa

DBGET integrated database retrieval system