KEGG   Pyrenophora teres: PTT_00962Help
Entry
PTT_00962         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K08738  cytochrome c
Organism
pte  Pyrenophora teres
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrome-c551 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: EFQ96466
UniProt: E3RCS8
Position
Unknown
AA seq 108 aa AA seqDB search
MDIDKGDHKKGANLFKTRCAQCHTLKEGEGNKIGPNLHGLWGRKTGQVEGYSYTDANKQK
GITWDDSTLYEYLENPKKYIPGTKMAFGGLKKPKDRNDLIHFLKEETK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgacaagggtgaccacaagaagggtgccaaccttttcaagacccgatgcgct
caatgccataccctgaaggagggtgagggcaacaagatcggccccaacctacacggcctc
tggggccgcaagactggtcaggtcgagggctactcatacaccgatgccaacaagcaaaag
ggcatcacctgggacgacagcactctgtacgagtaccttgagaaccccaagaagtacatt
cccggtaccaagatggcctttggtggtctcaagaagcccaaggaccgtaacgacttgatc
cacttcctcaaggaggagaccaagtaa

DBGET integrated database retrieval system