KEGG   Pyrenophora teres: PTT_00963Help
Entry
PTT_00963         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PTT_00963
Protein kinases [BR:pte01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   PTT_00963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 427 aa AA seqDB search
MSWRRSEKLMDTIKHYSNFPATGVSLRQMVQFGEKPSTGTLFRASQFLSEELPIRLAHRV
QELNDLPDGLNEMPSICRVRDWYAQSFEELVQLPRPNLSSDIKERLLKPAKKAGDKSLMS
KPTQNPSIKTGQYRSAPTNGHGNGNGNTITKEVKGASRRYYAAADDGQDWPPELAAYNTK
FADTLEKIKRRHDSVVTTVAQGILEWKRKRQRLQIDHNIQAFLDRFYMSRIGIRMLIGQH
IALTDQRSRTDPNYVGIICTKTNVQELAQEAIENARFVCEDHYGLFDAPKVQLVCNPDIS
FMYVPGHLSHMLFETLKNSLRAVVERHGQEREAFPVTKVIVAEGKEDITIKISDEGGGIP
RSSIPLVWTYMYTTVDQTPSLDPDFNKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISM
EGYVPKT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggagacggagcgagaagctgatggacacgatcaaacactacagcaacttccca
gccacaggtgtttccctacggcagatggtgcagtttggagagaaaccctctaccggaacc
ctcttccgcgcgtcgcagttcctttctgaagaactgcccatccggttagcacaccgagtg
caggagctcaacgaccttcccgatggacttaatgagatgccatctatatgccgcgtgcgc
gattggtatgcgcaatcgtttgaagaactcgtgcaattgccccggccgaatctctcgagc
gacatcaaagaacggctactcaagccggcgaagaaggctggcgataagagtttgatgagc
aagccgacacaaaatccaagtatcaagacgggccagtaccgatccgcaccgacgaatggc
cacggcaatggaaatggcaacacaatcacaaaggaagtcaagggtgcgagtcggagatac
tacgcagctgcagacgacggacaagattggccaccagaattggccgcctacaacacaaag
tttgcagacacattggagaagatcaagaggcggcatgacagcgtcgttaccactgttgcg
caaggcatcttggagtggaagcgcaagcggcaacggttacaaatcgaccataacatacag
gcttttctcgatcgtttctacatgtctcgcattggcattcgcatgctcatcggccaacac
atcgcccttaccgaccaacgctcacggacggacccaaactacgttggaataatctgcaca
aagacgaacgtccaggaacttgcacaggaggctattgaaaacgcgcgctttgtgtgtgaa
gatcattacggcttatttgacgcgccgaaagtgcagctagtgtgcaacccggacattagc
ttcatgtacgttcctggccatctatcgcacatgctcttcgaaacactcaagaactcgcta
cgtgccgtggtggaacgacatggacaagagagggaagccttcccagtaacaaaggtcatt
gtagcagagggaaaggaggacatcacgattaagatttcggatgaaggaggtggcattcct
agatcatcaattccgttggtatggacgtacatgtacacgacggtcgatcaaacaccaagc
ctggacccggatttcaacaagagtgacttcaaggcaccaatggctgggtttggttatgga
ctaccaatttctaggctttatgcgcggtactttggtggcgacctgaagctgatttcgatg
gaagggtatgtaccgaagacttga

DBGET integrated database retrieval system