KEGG   Pyrenophora teres: PTT_01318Help
Entry
PTT_01318         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pte  Pyrenophora teres
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PTT_01318
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PTT_01318
Transfer RNA biogenesis [BR:pte03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PTT_01318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MAYSAELRLALRAVHRAALLTKSVLRSLSNNVSAETKADDSPVTIADFAAQALLISALLA
VYPNDRFLGEESADALRQNEQLADRVWQLVQQAKEEAHAASNGTGNEEEAQKHVRDEAQL
VFPASKNDMFDLIDRGGKGQDTGRGRVWVMDPVDGTATFMQGQQYAVCLCLLVDGVQQVG
VIACPNLAFPIQGALGQTRIHEDTVDKDGHGVILSAVKGQGTFIRSMTAHGLGTDIRHVD
LTTLPPKKPSELNFVEATLGKTSLSQPEHKAVATSLGASWPGTVIWSQQMKYVALTLGAT
DVMVRIPKTLDRFTYVWDHAGGHLLYQEAGGVISDFNGEQIDFSQGRKITGERNWGMVAC
LPAYFEEVGKSVKEVLKKRDS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcctattcggcagagctccgcttggccctgcgtgccgtccaccgggccgccctgctt
accaaatccgtactccgcagcctctccaacaacgtgtctgcagagacaaaagcagacgac
agtcccgtcacgattgcggactttgccgcccaggcgctcctcatttctgccctgctagcc
gtgtatccaaacgaccgctttctaggcgaggagagcgcagatgcattgcgccagaatgag
cagctcgccgaccgcgtctggcaacttgtgcaacaggcaaaggaagaggctcatgcagct
tccaacggaactggcaacgaagaggaggcgcagaagcacgtgcgggatgaggcacaacta
gtctttcccgcatccaaaaacgacatgtttgatcttattgaccgcggaggcaaaggccag
gacacggggagaggtcgggtatgggttatggatcccgtggatggaacggcgactttcatg
caaggccagcaatatgccgtttgtctctgtttgctcgtcgacggcgtgcagcaagtaggc
gtcatcgcgtgtccgaacctcgccttccccatccaaggcgccctcggccaaacccgcatc
cacgaagacacggtcgacaaagatggccacggcgtcatcctctccgccgtcaaaggccaa
ggaacctttatccgcagcatgaccgcccacggcctaggaaccgacatccgccacgtagac
ctaaccactctgccccccaaaaagccctctgaactcaactttgtcgaagcaacactaggc
aaaacatcgctctcgcaacccgaacacaaggccgttgccacctcgctcggcgccagctgg
ccgggaaccgtcatctggtcccagcagatgaagtatgtagccctcaccctcggcgcaaca
gacgtcatggtgcgcatcccaaagacgctcgaccgcttcacctacgtctgggatcacgcc
ggcggccacctgctgtaccaggaggctggcggtgtgattagcgacttcaacggcgagcaa
atcgacttttcgcagggcaggaaaatcaccggcgagcgcaattggggcatggtggcttgc
ttgcccgcctactttgaagaagtgggtaagagcgtcaaggaagtactgaagaagagggat
agttga

  All links  
No link information was found.   
DBGET integrated database retrieval system