KEGG   Pyrenophora teres: PTT_03489Help
Entry
PTT_03489         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PTT_03489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 219 aa AA seqDB search
MGQLDNGWLLCKFDPGEDAGDGLIRRKVIHYIYRAIISPLFLNPSMSPMHISVWLSGFAF
QVLNAISIGGYLAGYGPTSQFEWAAREEWVFVGLVIWCWGLMGNMFHDDDLREIRRSADR
KQRKEAKEQGKAVESVDKIYMIPKNGLFKYSLHAHYLCEWIEWGGWWIIGGWKCHPARTF
LLNEIATMLPRALQGKRWYEKKFGKEKLQGRKAIIPGLV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggggcaattggacaatggctggttgctttgtaagtttgacccgggcgaagatgcagga
gatggactcatcagacgtaaggtcatccactacatatatcgcgcaatcatctcgccactc
ttcctcaaccccagcatgtctcctatgcacatatcggtttggttgtctggctttgctttt
caagtgttgaacgcaatttcgattggcggataccttgcaggctatggcccgacatcgcaa
ttcgagtgggcggcgcgagaggaatgggtgtttgtcggactcgtcatctggtgctggggg
ctcatgggcaacatgtttcacgacgacgacttgcgcgagattcggcgatcagcggaccgc
aagcagcgcaaggaagccaaggagcagggtaaagcggtagagagtgtggacaagatctac
atgatcccaaagaatgggctcttcaaatactcgctgcacgcacactacctctgcgaatgg
atcgagtggggagggtggtggattattggggggtggaaatgccatccagcgcgcacgttt
ttgctcaacgagattgcgacgatgctgccacgtgcgctgcagggcaagcgatggtacgag
aagaagtttgggaaggaaaagcttcaaggccgcaaggcgatcattccgggcttggtataa

DBGET integrated database retrieval system