KEGG   Pyrenophora teres: PTT_03632Help
Entry
PTT_03632         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pte  Pyrenophora teres
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTT_03632
Enzymes [BR:pte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PTT_03632
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C44
   PTT_03632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 581 aa AA seqDB search
MCGIFACYRHPDVQKFKPTALKMGKAVRHRGPDWSGNWVANDTILVHERLSIVGVESGAQ
PLVNDEQTVSLAVNGEIYNHRILRKSLKKPYNFKTHSDCEVIIPLYLEHDIDAPRKLDGM
FSWVLHDKTQDRVIAARDPIGITTFYMGRSSTTPGAVFFASELKCLHPVCDNIISFPPGH
VYDSKTDSLTRYYDPKWLVEPESIPSTPVDYKELRQSLERSVRKRMMAEVPFGVLLSGGL
DSSLVASIAQRETLRLNEATRKKAATSSGAASEQQNQLVGIDDSNELQTDLLLGQLNSFS
IGLPNSPDGVAAQEVANFLGTKHHTFTFTIEDGLNALTDVIFHLETFDVTTIRASTPMFL
LSRKIKAMGVKMVLSGEGSDEIFGGYLYFHNAPDKAAFHQECIRRVKNLHLADCLRANKS
TSAWGVEARVPFLDKEFLNTAMNIDPADKLIDRKNGRMEKYILRKAFDTSDEPDTQPYLP
DKILWRQKEQFSDGVGYGWIDALKDTAELHVTDEMMKNPKPEWGSDIPDTKEAYWYRCMF
DEHFPSYCADTVMRWTPTWSDQTDPSGRAIGVHEQKYAHAK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcttcgcctgctacagacatcccgatgtacaaaagttcaagccgacggcc
ctgaaaatgggcaaggctgtccgacatcggggtcctgattggagtggcaactgggtcgcg
aacgataccatccttgtccatgaacgcttgagcattgtcggcgtcgagtctggagctcag
ccgctcgtcaacgacgagcagacagtgtcactagctgttaatggcgaaatctacaaccac
cgtatcctccgcaagtcgctcaagaagccgtacaacttcaagacacactctgactgcgag
gtcatcattcctctgtatcttgaacatgatattgatgcgccccgcaaattggacggcatg
ttctcgtgggttctccacgacaagactcaagatcgtgtaatcgccgcacgagaccccatt
ggcatcactaccttttacatgggcagatcgagcacaacgcccggcgcagtcttcttcgct
tccgagctcaagtgtctccatcccgtatgcgacaacatcatctccttcccgcccggccac
gtctacgactccaagacggactcgcttacccgctactacgaccccaagtggctagtcgag
cctgagagcattccttcgacacctgttgactacaaggagctgaggcaatcattggagcgg
tcagtgcggaagcgcatgatggctgaagtgccctttggtgtgcttctctctggtgggctt
gactcgagtcttgtggcttctatcgcgcagcgggaaactctgcgactgaacgaggcgaca
aggaaaaaggccgccacgtcttcaggagccgccagtgagcagcagaaccagctcgtgggt
atcgacgactccaacgagctccagactgatcttctcctgggacagctcaactccttttcc
attggtctgcccaactctcctgatggcgtcgccgcacaagaagtggccaacttccttgga
accaagcaccacacctttacctttactatcgaggatggcctcaacgctctcacagacgtc
atcttccacctcgaaacctttgatgtgacgacaatccgcgcctcaacacccatgttcctg
ttgagccgaaaaatcaaggccatgggcgtcaagatggtgctttcgggagaaggcagcgac
gagatctttggtggatacttgtacttccacaacgcccctgacaaggccgcattccaccaa
gagtgcatccgccgtgtcaagaacctgcaccttgccgactgtctacgcgccaacaagtcg
acatcggcctggggtgtcgaagctcgtgtcccctttttggacaaggagttcctcaacact
gccatgaacattgacccggctgataagctcatcgaccgcaagaatggtcgcatggaaaag
tacattctacgcaaggcctttgacacatccgacgagccagacacgcagccctacctccct
gacaagatcctctggaggcaaaaggaacaattctccgacggcgtgggctacggatggatc
gacgcgctcaaggacacggccgagctgcatgttacggatgaaatgatgaagaaccccaag
cctgagtggggcagcgatatccccgatacaaaggaggcgtactggtacaggtgcatgttt
gacgaacactttcctagctattgcgccgataccgtcatgcgctggacgccgacgtggagt
gaccagacggatccctctggacgggctattggcgttcacgagcagaaatacgctcatgcc
aagtag

DBGET integrated database retrieval system