KEGG   Pyrenophora teres: PTT_05234Help
Entry
PTT_05234         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_05234
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PTT_05234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MPDQIHHESGAGANVSEHTTHEQAKEQAAPSMMPANPASDTVSSSAEQTEKTPATKTSNG
STSPIATPKAALNARKRGLPEPSVESEPSSKKYKDSPSPPSSRLSSIQRFPSPPEMPATA
FDKETWQGFCDIESEPACFSVILREMGVQDVTVREVFSMDQDFILENVPQPIYGFILLFH
YREFGNDNQADECPKNVWFANQLPAQNSCATLAMINILMNQSDEAVIGEHLEQFKDFTNH
FTPYQRGEAFASFDFVKKIHNSFAKKMDILEGDKHLSSKVRRAERLKVQAVAEKIKPSKR
STKSRRSSPDSVGSNNSSESVESSAHHYIAFVPVGNQVWKLDGLDKQPTPVGSFDTDNGE
TWLR
NT seq 1091 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcagattcatcacgaatcgggagctggcgctaacgtcagcgagcacaccacg
cacgagcaagccaaagagcaagcagcccccagcatgatgccagcaaaccctgcaagcgat
acagtttcttcaagcgctgagcaaaccgaaaagacacccgcaactaaaacatccaatggt
tccacatccccaattgcgactcccaaggccgccctgaacgctaggaagcgaggtcttccc
gagccctccgtagaatccgaacccagtagcaagaagtacaaagattctccatcgccacca
tccagccgactgtcgtcaatacaacgcttccccagcccaccagaaatgccagcaactgcc
tttgacaaagagacttggcagggattttgcgatatcgaaagtgagcccgcgtgcttcagc
gtcatcctccgtgagatgggcgttcaggacgtcacagtccgcgaggtattcagcatggac
caggacttcatcctcgagaacgtgccgcagccaatctacggcttcattctgctgttccac
tatcgtgagtttggcaacgacaaccaggccgacgagtgccccaagaacgtgtggtttgcg
aatcaactcccagcccagaacagctgtgccacgcttgctatgatcaacatcctcatgaac
cagagcgacgaggctgtcatcggcgagcatctagagcaattcaaggactttaccaaccac
ttcaccccgtaccagcgcggcgaggcgtttgcgagcttcgactttgtcaagaagatccat
aactcattcgccaagaagatggacattcttgaaggcgacaagcatctcagttcaaaggtc
agacgcgccgagcgcctcaaggttcaagcggttgccgagaagatcaagccgagtaagaga
agcaccaaatctcggcgttcttcccccgactcggtaggctcgaacaatagctcggagagc
gtggagagtagtgcacaccactacatcgcctttgtgccagtcggcaaccaagtctggaaa
ctagatggcctagacaagcagccaacccccgtcggatcctttgacactgacaacggagag
acatggctgcg

DBGET integrated database retrieval system