KEGG   Pyrenophora teres: PTT_06069Help
Entry
PTT_06069         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pte  Pyrenophora teres
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PTT_06069
Translation factors [BR:pte03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PTT_06069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 828 aa AA seqDB search
MASTYSNLPMDGDDEFDESQIDFTDIEDQFQVRLDEGLDAFVVIDGLPVVPEDSKGKLVK
FVLRKLNSVGKVKDDGVHMPVSDSGKTEGYAFVEYSAPAEAVAAVKQLNGTPLDKKHTMA
VNKLTDIDRYGKEGRIDDEYHPPEIPPFEQKEHLRWWLGDPESRDQMAMYRQEKVGVFWN
EKEDQPEQVVDRENWTESFIQWSPQGTYLTSMHAQGVQLWGGKAWSRQKRFAHPGVNLVD
FSPSEQYLTTWSHRPLQVDENHPVPSLSLEEDGKNYIIWDIATGKPLRSFATIDVPGGID
AEGNPVKKKLQWPTFKWSSDDKYVARMTQGQSISIYELPRMNLLDKTSIKIEGVMDFEWA
PATPRRDGIKTYEQLFCYWTPELGSNPAKVGLMSVPSKEIVRTRNLFNVSDAKLHWQSEA
AYVCVKVDRHSKSKKSLATNLEIFRVREKGVPVEVVDSIKDTVINFAWEPKGNRFVLITT
GEVIQGAAVGPKTAVSFFAPEKLKGGAPGNFRHIRTVDKKNSNAIYWSPKGRFVVIAALQ
SQQSFELEFWDMSFDRPKEDSEKGDKEVNASLQLMDTAEHYGVSDIEWDPTGRYVATVAS
AFRHRMENGYHLYDFKGTLLREEAIEGFKQLLWRPRPPTLLSKEEQAEIRKNLRNYSKVF
DEQDLAKKSSANKAVVEARREMLDEWRRWREEVTQRLQDEGAYLELALLKGETPGQADDG
HQEEIEEIVEEIIEETEEVEILATTTVPLGAQDKGAYSVDYNGGPGFTEYIAKRGDVKDV
AADVAYAVREGGAAEGWGIEVDGGYVISFGGEERGDYGGAYETAAACY
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaacatactcaaatctgcccatggacggcgacgatgaattcgacgagagccaa
atcgactttaccgatatcgaggaccagttccaggtgcgacttgatgaggggctcgatgcc
tttgtcgtaattgatggtctgcccgtagtgcctgaggacagcaagggcaaactggtcaag
tttgtgctgcgcaagctcaacagcgtgggaaaagtcaaggatgatggcgtacacatgccc
gtgagcgactcgggcaagacggagggatatgcattcgtcgaatacagcgcgcccgcagag
gcggtggctgcagttaagcagctcaacggcaccccactcgacaagaagcacaccatggcc
gtcaacaagctcactgacattgatcgctatggtaaagagggccgcatcgacgacgaatac
cacccgcccgagatcccaccattcgaacaaaaggagcatctacgctggtggttgggagac
cccgaaagtcgcgaccaaatggccatgtaccgccaagagaaggttggtgtcttctggaac
gagaaggaggaccagcctgaacaggtcgtggatcgcgagaactggaccgaatccttcatc
cagtggtcgccccagggaacctaccttacctcgatgcacgcccaaggtgtgcagctgtgg
ggaggtaaggcatggagtcgccagaagcgcttcgcccaccccggtgtcaaccttgtcgac
ttctcgcccagcgaacagtacctcaccacctggtcccaccgccccctacaggtcgacgag
aaccacccggttccatcgctatcactcgaggaggacggcaagaactacatcatctgggac
atagctaccggcaagcctctgcgctccttcgccacaatcgacgtccccggcggtatcgat
gccgaaggcaatcccgtcaagaagaagctgcaatggccgacattcaagtggtcttcagac
gacaagtatgttgcgcgcatgacccagggccagtccatttccatctacgagctgccccgt
atgaaccttcttgacaagacgtcgatcaagattgagggtgttatggactttgaatgggct
cccgcaacaccccgcagagacggcatcaagacatacgaacagctcttctgctactggaca
cccgagctcggcagcaaccccgcaaaggtcgggcttatgtccgttccttccaaggaaatt
gttcgcacccgaaacctcttcaacgtctccgatgccaagctgcactggcaatcagaagcc
gcttacgtctgcgtcaaggtcgaccgtcactcaaaatccaagaagtctctcgccacaaac
ctcgaaattttccgtgtccgcgaaaagggcgttcccgttgaagtcgtcgactccatcaag
gacaccgtcatcaactttgcatgggaaccaaagggcaaccgcttcgtgctcatcaccact
ggtgaagtaattcagggcgctgctgtcggtcccaagactgccgtatctttcttcgctcct
gaaaagctcaagggtggcgcaccaggcaacttccgccacattcgaaccgtcgacaagaag
aacagcaacgccatctactggtcgcccaagggacgattcgtcgttattgctgccctccag
tctcagcagtcgtttgaacttgagttctgggacatgagcttcgacaggccaaaggaggat
tccgaaaagggcgacaaagaggtcaacgccagtctacaacttatggacaccgccgagcat
tatggtgtttcagacattgaatgggaccctaccggtcgctatgtcgccactgttgccagt
gctttccgtcatcgcatggagaacggctaccacctctacgacttcaagggtacacttcta
cgggaagaagccattgaaggcttcaagcaactcctctggcgtccacgacccccaacactg
ctttccaaggaagagcaggccgagatccgtaaaaacctacgcaactactccaaggtcttt
gacgagcaggatcttgccaagaagagctccgcaaacaaggctgttgtggaagcccgtcgt
gaaatgctcgacgaatggcgcaggtggcgcgaggaggttacacagagacttcaagacgag
ggtgcgtacctggagcttgcattgctcaagggagagactcccggacaggcggatgatggc
caccaggaggagattgaggagattgtagaagagattattgaggaaactgaggaagtcgaa
atcttggccacgactactgtaccgcttggtgcccaagataaaggcgcctacagtgtggac
tacaatggcgggccgggcttcacggaatacattgcgaagagaggagacgtcaaggatgtc
gcagcggacgtagcgtacgctgtgcgtgaaggcggtgctgccgagggatgggggattgag
gtcgatggcggttatgttatatcttttggtggcgaggagcgcggagattatggaggtgcc
tatgaaaccgcagccgcctgttactag

DBGET integrated database retrieval system