KEGG   Pyrenophora teres: PTT_06596Help
Entry
PTT_06596         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pte  Pyrenophora teres
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PTT_06596
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PTT_06596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 515 aa AA seqDB search
MASAAGPDNPFRDVSDSLVAPVAPSHSPEPARETTSVADTLNVGSTASLTLGTDSLVILD
ETRVDNKSTCCGLSLAGKNKSTRSIPFYNILWAEHAEDGNIIIEYAQTISKTSVRPAVIS
YPLDKPGSAVAAAWIEKLLDRAYGASQRNKRIKVLINPFGGPGGAEKTYYKQIAPIFTSA
RCELSVEKTQYNGHAVEIGQNLDIDTYDVVACCSGDGVPHEVWNGLGKRQDAARALYKTA
VVQLPCGSGNALSWNFNGTNDASTAALAVVKGLRTPLDLASITQGNQRILSFLSQTLGII
AEADLATEHLRWMGGHRFTWGILTRLLTKKMYPADIAVKVEHATKPAIRAFYRAEASKAS
PTTDSRPLPPAIQGLPPLQYGTSNDPLPESWSLIPHPSLGNFYAGNIAYMSANANFFPAS
LPADGCLDLVRIRGDIPRHRALKAFQAVENGTIFDMEDVDYQKISAYRILPKQQKEGDIS
VDGERLPFEGFQVEVHRGLGTTLSKSGHLCEARGV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagctgcaggcccagacaacccgtttcgagacgttagcgactctctagtcgcc
cctgttgcgccctcgcattcgcccgaacctgctcgggagacgacaagcgtggctgacact
ctcaatgtcggctcaactgcgtcgctgacactcggaaccgactcgctggtcatcctggac
gaaacccgcgtagacaacaagagcacctgttgcggcctttctcttgctggcaagaacaag
tccactcgttcaatcccattttacaatattctttgggctgaacatgccgaagacggcaac
attattatcgagtatgcgcagaccatatccaagacgagcgtgcggcctgccgttattagc
tatcctttggacaagccgggcagtgcggtcgcagcagcttggatagagaagctactggac
cgcgcatatggcgcctcgcagcgcaacaagcgcatcaaggtgctcatcaacccatttgga
ggaccaggcggcgcggagaagacatactacaagcagattgcgcccatctttacgtcagca
agatgtgagctgagcgtggagaagacacaatacaacggtcacgcggttgaaattgggcag
aacctggatatcgacacatacgacgtcgtggcctgctgttcaggagacggggtcccacac
gaagtttggaatggactgggcaagcgacaagacgcagcgcgagctctctacaagacagcc
gtcgtacaactcccttgcgggtctggcaacgctctgagctggaactttaacggcacaaac
gacgccagcactgcagcgctcgctgttgtaaagggcttacgcacaccactggatttagcc
tccataacccaaggcaatcagcgcatcctctcctttctctcccaaacccttggcatcatc
gccgaagccgaccttgccaccgaacacctccgctggatgggcggccaccgcttcacctgg
ggcatcttaacgcgcctcctcaccaagaaaatgtaccccgccgacatcgccgtcaaagtc
gaacacgcaaccaaacccgcaatccgcgccttctaccgcgcagaagcctcaaaagcttcc
cccacaacagactcccgccccctaccccccgcaatccagggcctaccccccctacaatac
ggcaccagcaacgaccccttaccagaatcctggtccctaatcccccacccctcgctcgga
aacttctacgcaggaaacatcgcttacatgtccgcaaacgcaaacttcttcccggcctcc
ctccccgctgacggctgtctcgacctcgtccgcatccgcggcgatattccgcgtcaccgc
gcccttaaagctttccaggctgtcgaaaacggcacaattttcgacatggaagatgtggat
tatcagaaaatcagcgcgtatcgcattttgccgaaacagcagaaagagggtgatatcagt
gtggatggcgagaggctgccttttgaggggtttcaggttgaggtgcacaggggattgggg
actacgttgagtaagagtgggcatttgtgtgaggcgaggggggtgtag

DBGET integrated database retrieval system