KEGG   Pyrenophora teres: PTT_06995Help
Entry
PTT_06995         CDS       T01613                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pte  Pyrenophora teres
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PTT_06995
Enzymes [BR:pte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     PTT_06995
Glycosyltransferases [BR:pte01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PTT_06995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 775 aa AA seqDB search
MSSPPGTLRQRTGKDKKRPVSPNPDALSEKVANFVEKAKPAMDKVKPYKAAQQGGEWDYK
LAIVVMTVLAFITRFWGIRHPDQVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFAG
WLVGYKGDFLFENIGDSYITNKVPYVAYRAMPASLGALTVPIVFMIMWESGYSLPACITA
AGLMLFDNAHIGQTRLILLDASLIFFMALSVLSYIRFYKERHAPFGAKWWKWLLLTGVNL
SCVISIKYVGVFTFFSIGVPVMIDLWDLMDVNRRQGALTLAEFGKHFAARAVGLIIVPFF
LYLFWFQVHFSILTRSGPGDDFMTPEFQETLSDNVMNLQSVGINYYDSITIRHKETKVYL
HSHPDRYPLRYDDGRVSSQGQQVTGYPHNDTNNHWQVLPSKPLPSEEGQRVKVGDVIRLR
HLITDTILLTHDVASPYYPTNQEFTTVTKDEASGARYNETLFEIKTDKSKGDFTTMSTHF
KLIHVPTKVAMWTHTKPLPDWAYKQAEINGNKALQASSNIWYVDDIPSLPAEDVRNKKEP
KQVKHLGFLRKWVEVQRAMFYHNNALTSSHPYASQPISWPFLLRGVSFWTHNDTREQIYF
LGNPLGWWLASSLLAVFAGIIGADQLALRRGMDALDERTRSRLYNSTGFFFLTWAAHYIP
FYIMGRQLFLHHYLPAHLASCLVTGALVEFVFCIEPQDPETPGAVKGHRRTRSRPVRERV
ATSSLMGSWIACGVILAAVFWCFLFFAPLTYGSPGLSITQVQMRKWLGYDLHFAK
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccctcctggcaccctgcgccagcgaacaggcaaggacaagaagcgccccgtc
tcacccaacccagacgccttgtccgagaaggtcgccaatttcgttgagaaggcgaagccg
gccatggacaaggtcaagccgtacaaggctgcccagcagggtggtgaatgggattacaag
cttgccattgtcgtcatgacggttcttgcctttattacgcgcttctggggcatcagacac
cctgatcaggttgtcttcgacgaggtgcactttggaaagtttgcttcctattacctccaa
cgaacctactttttcgatgtccaccctccgtttggaaagctcctcttcgccttcgctggc
tggctcgtcggatacaagggcgacttcttgtttgagaatattggcgattcctacatcacc
aacaaggtgccctatgtcgcctaccgcgccatgcccgcctcgctcggcgcgctcacggtc
ccgattgtcttcatgatcatgtgggagtctggatactcgctccctgcctgcatcaccgcc
gccggtctgatgctcttcgacaacgcccacattggccagacacgccttattctcctggac
gcctcgctcatcttcttcatggccctctccgtcttgtcctatattcgcttttacaaggag
cgacacgctccttttggtgcgaaatggtggaagtggctgcttctcaccggcgtcaacctg
agctgcgtcatctccatcaaatacgtcggtgtcttcactttcttctccatcggtgtcccg
gtcatgattgacttgtgggacttgatggacgtcaaccgccgccagggcgccttgactctt
gctgaatttggcaagcactttgctgcccgcgctgtcggtctgatcatcgttccctttttc
ctgtaccttttctggttccaggttcatttttccattctcacccgctctggaccaggcgac
gacttcatgaccccagagttccaggagactctgagcgacaacgttatgaacttacagtct
gttggtatcaactactacgattccattaccatccgccacaaggagaccaaggtctacctc
cacagccaccccgaccgttacccgctccgatacgacgatggacgtgtttcttcacaggga
cagcaggttactggatacccccacaacgataccaacaaccactggcaggtcctcccgtcg
aagcctctgccgagtgaagagggccagcgcgtcaaggtgggagatgtaatccgtctccgc
catttgatcaccgacaccattctcttgacacacgacgttgcatctccttactaccctact
aaccaggagttcaccaccgtaaccaaggatgaagcctccggcgcacgttacaacgagact
ctgtttgaaatcaaaaccgacaagagcaagggcgatttcaccaccatgtcgactcacttc
aagcttattcacgtgcccaccaaggtcgccatgtggactcataccaagcctctcccagat
tgggcctacaagcaggctgaaatcaacggcaacaaggctcttcaagcatccagcaacatc
tggtatgttgacgacattccgtctctgcctgccgaggacgtgcgcaacaagaaggagccc
aagcaagtcaagcatctcggcttcttgaggaagtgggtcgaagtacagcgcgccatgttc
taccataacaacgccttgaccagctcgcatccatatgcttctcagcccatctcctggccc
ttcctcctccgcggtgtctccttctggacccacaacgacacgcgcgaacaaatctatttc
cttggtaacccgcttggatggtggcttgcatcctcgcttcttgcagtattcgctggtatc
atcggcgccgaccaacttgcgctccgccgcggtatggacgctctcgacgaacgtacccgc
tcccgtctatacaactccaccggcttcttcttcctcacttgggccgcccactacatcccc
ttctacatcatgggccgccaactcttcctccaccactatctccccgcccacctcgcctcc
tgcctcgtcactggtgccctcgtcgaattcgtcttttgcattgaacctcaggacccggag
acccccggtgccgtcaagggacatcgccgcactcgctcccgccctgttcgcgagcgcgtc
gctacgtctagtctgatgggtagctggattgcgtgcggcgtcattctcgcagcagtgttt
tggtgcttcctcttctttgctccgcttacgtatggtagcccgggtctttccatcacccag
gttcagatgaggaagtggctaggatatgatttgcactttgctaaatag

DBGET integrated database retrieval system