KEGG   Pyrenophora teres: PTT_07134Help
Entry
PTT_07134         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
  KO
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PTT_07134
Peptidases [BR:pte01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PTT_07134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 667 aa AA seqDB search
MNYNQFPEFEAYQQRWNSTTDSHTTITTVILGAIIALFALFKAFNFLGYPVSLWVYRFLQ
MATDVLRLRGSSFSSTSSESTDDETMQRGGMLGSLFALSPGGLIQKGVRGVANALSIGPS
EVPPGLGNISNSCYQNSVIQGLASLPSLRDHLAKIMSENPSLTPESTNGALFEIITKLNN
PENKGQHFWIRGKLKSMSTFEQQDAQEYFSKILDALDEEIKKTASSKRRSSVSWLEVTKS
LSNSPATVGDAKDGAKDEADKSGPSPEHIPSNPLEGRLAQRVGCTSCGYSEGLTLIPFNC
ITVSLGKNNGYDIRDCLDEYTTLEFIDGVECAKCTLLKLQKTLTPLITAKPESPLKARLD
AVQEALEKEDFEDKTLLKTLNVPKKNWVQSTKSKQAVVARAPQSLVLHVNRSSFNEYTGM
PYKNTAGVTYPTVLDLGNWCLGGVPKDSEPAAASEEEWPRDPTESMLAKGEPMSDSPFQY
RLRAAVTHYGSHGNGHYVCYRSHPKPAPKIEVQENTEAVATEDEDVEEVQANELQQAAIE
PESEQWWRFSDDSVYAVSEQEAHQGNVFMLFYERIDESTSSAHQAATVSTSVAQDASLPT
VDVASITPTSADDEAVTIALPEEENADDLLDLSPSEPAPELSQPHLEPPATQQPEAAEPV
HPSSPRL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaactacaatcagttcccagagtttgaagcataccaacaacgctggaattctaccaca
gactcgcatactaccatcactaccgtcatcctaggcgccatcatagcactattcgccctt
ttcaaggcgtttaattttttgggctatccagtctcgctttgggtataccggttcctacaa
atggctacggacgtgttacgcctgcgtgggtcgtcgttcagttcgacgtcttccgagtcc
actgatgacgagacaatgcagcgtggaggcatgctgggaagcctctttgcgctgagcccg
gggggcctgatacagaaaggagtacgcggtgtcgcgaacgccctctccataggccccagc
gaagtgccccctggcttgggcaatatcagcaactcttgctaccagaatagtgtcatccag
ggccttgcctcgcttccttcgttacgcgaccatctcgccaagatcatgtccgaaaacccc
tcgctcacacccgaaagcacaaacggtgcgctcttcgaaatcataaccaagctcaacaac
ccagagaacaagggccagcatttctggattcgcggcaagctaaagtcgatgagcactttc
gaacaacaggatgcgcaggagtattttagcaagattttggacgcgctggatgaagagatc
aagaagactgccagtagtaagcggcgatcctctgtctcctggcttgaagttacaaagagc
cttagcaactcaccagctacagttggagacgcaaaagacggagcaaaagacgaagcggac
aagtcgggaccgtcgcctgagcatattccctcgaacccactcgagggccgcctcgcccag
cgcgtcggctgcacatcttgtggctactcagaaggccttacactcatcccgttcaactgc
atcaccgtatcgcttggcaagaacaacggctacgacattagggattgtcttgacgagtac
actacactggagtttatcgatggtgtggaatgcgcaaagtgcacgctgcttaagctgcag
aagacgctgaccccactgatcaccgctaagcctgaatccccactgaaagcacgtctggac
gctgtacaagaggcactggaaaaggaggattttgaggacaagacacttcttaagacgctt
aatgtgccgaagaagaactgggtacagagcacaaagtccaagcaggcggtcgtggcacgt
gcgcctcagtcattggtactccatgtcaaccgcagcagtttcaatgagtacactggtatg
ccgtacaagaacaccgccggtgttacatatccgactgtactagacctggggaactggtgc
ttgggtggcgtaccgaaggactcagaaccggccgctgcgtcagaggaagaatggccacgg
gatccgacagaatctatgctagccaagggggaaccaatgtcagattcgccattccaatac
cggttgcgcgctgctgttacgcattacggctcgcatggtaacggccactatgtctgttat
cgttcgcacccaaagcctgcgcccaagatcgaggttcaggagaatactgaagctgtagca
acggaagatgaggatgtcgaagaagttcaggcaaatgagttacagcaagcggccattgaa
ccagagtcggagcagtggtggcgattcagtgatgacagcgtctacgccgtctcggagcag
gaagcgcaccagggcaacgtctttatgctcttctatgagcgtatcgatgagtcaacgtct
tccgcacatcaggccgcaacagtgtctacttcggtagcccaagacgcctcattgccaaca
gttgatgtcgcatcgattactccaacatcagcggacgatgaggctgttaccattgctcta
cctgaagaagaaaatgccgacgatctgctcgacctgagcccctcagaacctgccccagaa
ctctcacaaccccatctcgaaccccctgcaactcagcagcccgaagccgcagaacccgtg
catccatcatcgccacgactc

DBGET integrated database retrieval system